DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10802 and AlaRS

DIOPT Version :9

Sequence 1:NP_570062.1 Gene:CG10802 / 31318 FlyBaseID:FBgn0029664 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_523511.2 Gene:AlaRS / 34156 FlyBaseID:FBgn0027094 Length:966 Species:Drosophila melanogaster


Alignment Length:484 Identity:98/484 - (20%)
Similarity:170/484 - (35%) Gaps:122/484 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FLKEFKTKIVSSEFATLDWTDPSGKVEKLKGFNVICEDTILFPEGGGQPCDYGTL-------GGF 67
            |..:|..:|.|.:.|                 .::.:.|..:.|.|||..|.|.|       ..|
  Fly   513 FENQFVNEITSGQKA-----------------GIVLDKTNFYAESGGQIYDQGALVKVNDEANEF 560

  Fly    68 PVKNVQRKGSTAVHFVESPTSFEQDAEVLLTLDYQRRLDHMQQHSGQHLITALFDREFKYDTTSW 132
            .|..|..:|...:|......:.:...|:.|.:|.:||...|:.||..|.:.....:....||.  
  Fly   561 LVDRVYNRGGYILHIGVVEGTLKVGDELELHIDVERRWLTMKNHSATHALNHCLLQVLGKDTE-- 623

  Fly   133 SLGSTVSYIQL----STPHLISRESLDLIERQANDLIREGREVTVLLVDPEVAQEFQDARAPRGL 193
            ..||.|...:|    ::...::.|.:...|:...:::.  :.|.:...:.::|.    |:..|||
  Fly   624 QKGSLVVPEKLRFDFNSKAAMTIEQVSKTEQLTKEMVY--KNVPIYAKESKLAL----AKKIRGL 682

  Fly   194 --------PKDHEGLARVVRIEGIESN------------MCCGTHVTNLSQLQCIKLLYAEKVKA 238
                    |.....::..|.::.:|.|            .|.|||:.....:....:...|.:..
  Fly   683 RSVFDEVYPDPVRVISFGVPVDELEQNPDSEAGEQTSVEFCGGTHLRRSGHIMDFVISSEEAIAK 747

  Fly   239 NV-LVHFVVGERVL--VKLGEVFQREQQLTQAL----KGGPG--QHLELVQKLQQNV-------- 286
            .: .:..:.|...|  :|..|.|::|....:|.    |.|..  .|::.:.:|.:.:        
  Fly   748 GIRRIVALTGPEALKALKKSEAFEQEIVRLKATIDNDKSGKDSKSHVKEIVELTEQISHATIPYV 812

  Fly   287 ---------KGSRKYFQQLLKRYATA-------EAERLCDLPKKDRPKYFSLHRRDGIEVDFINT 335
                     ||.:|......:....|       .|:.||:.    .|....|..:  :|. |.||
  Fly   813 KKDEMRNLLKGLKKTLDDKERALRAAVSVTVVERAKTLCEA----NPNATVLVEQ--LEA-FNNT 870

  Fly   336 -FLRAA--------PEGIFYFLTV---SESVFAGSSAKGHLVLRG------DPEIVGKLGPQFME 382
             .|.||        |:....||:|   |:.:|..||.....|.:|      ...:...||     
  Fly   871 KALDAALKQVRSQLPDAAAMFLSVDADSKKIFCLSSVPKSAVEKGLKANEWVQHVSATLG----- 930

  Fly   383 ILEGKGNGKEDNFQGKINNLARLQECQEL 411
               |||.||.::.|....|..::.|..:|
  Fly   931 ---GKGGGKPESAQASGTNYEKVDEIVQL 956

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10802NP_570062.1 AlaX 6..250 CDD:225427 51/271 (19%)
tRNA_SAD 43..229 CDD:298782 44/216 (20%)
AlaRSNP_523511.2 PLN02900 5..963 CDD:215487 98/484 (20%)
AlaRS_core 6..253 CDD:238360
tRNA_SAD 529..>626 CDD:298782 24/98 (24%)
tRNA_SAD 694..752 CDD:285247 8/57 (14%)
DHHA1 888..957 CDD:280440 20/77 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464491
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.