DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10804 and Y43D4A.1

DIOPT Version :9

Sequence 1:NP_001138150.1 Gene:CG10804 / 31317 FlyBaseID:FBgn0029663 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_502983.2 Gene:Y43D4A.1 / 189850 WormBaseID:WBGene00012787 Length:91 Species:Caenorhabditis elegans


Alignment Length:86 Identity:38/86 - (44%)
Similarity:50/86 - (58%) Gaps:12/86 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 SEASTSKAKAELVAIATASADQQ---DIVE---GEKEGEE------RESWDSKIMFLLATIGYAV 136
            ||..||..:....:.::|:.||:   .||.   ..||.||      |.:|.::|.|||:|:|.||
 Worm     5 SERMTSPTQRRSPSDSSAAEDQRIATTIVRDSGSSKEIEESQADPCRGAWGNQIEFLLSTLGMAV 69

  Fly   137 GLGNVWRFPYLAQKNGGGAFL 157
            ||||:||||..|..|||.|||
 Worm    70 GLGNIWRFPTRAYNNGGSAFL 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10804NP_001138150.1 SLC6sbd-B0AT-like 120..661 CDD:271364 24/38 (63%)
Y43D4A.1NP_502983.2 SLC5-6-like_sbd 52..>90 CDD:294310 22/37 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.