DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12206 and GRX7

DIOPT Version :10

Sequence 1:NP_570060.1 Gene:CG12206 / 31316 FlyBaseID:FBgn0029662 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_009570.1 Gene:GRX7 / 852302 SGDID:S000000218 Length:203 Species:Saccharomyces cerevisiae


Alignment Length:69 Identity:17/69 - (24%)
Similarity:27/69 - (39%) Gaps:17/69 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SNSNTEMSLKSQAAGMLLAFGDTAATAKDNLETSYDTA----------------AKSTAAPETNK 103
            ||::...|:.:.....|:.| |.:..|....::.:||.                |:..||.|.||
Yeast    30 SNASVNESITTHHPDSLVTF-DNSGNAPGTHQSVHDTVNTQDKEAEEVDKNSGDAEFDAAAEYNK 93

  Fly   104 IYPQ 107
            |..|
Yeast    94 IMEQ 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12206NP_570060.1 GRX_GRX_like 434..579 CDD:239329
GRX7NP_009570.1 GRX_GRXh_1_2_like 99..181 CDD:239511
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.