DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12206 and GRX7

DIOPT Version :9

Sequence 1:NP_570060.1 Gene:CG12206 / 31316 FlyBaseID:FBgn0029662 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_009570.1 Gene:GRX7 / 852302 SGDID:S000000218 Length:203 Species:Saccharomyces cerevisiae


Alignment Length:69 Identity:17/69 - (24%)
Similarity:27/69 - (39%) Gaps:17/69 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SNSNTEMSLKSQAAGMLLAFGDTAATAKDNLETSYDTA----------------AKSTAAPETNK 103
            ||::...|:.:.....|:.| |.:..|....::.:||.                |:..||.|.||
Yeast    30 SNASVNESITTHHPDSLVTF-DNSGNAPGTHQSVHDTVNTQDKEAEEVDKNSGDAEFDAAAEYNK 93

  Fly   104 IYPQ 107
            |..|
Yeast    94 IMEQ 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12206NP_570060.1 GRX_GRX_like 434..579 CDD:239329
GRX7NP_009570.1 GRX_GRXh_1_2_like 99..181 CDD:239511
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344897
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.