powered by:
Protein Alignment CG12206 and GRX7
DIOPT Version :9
Sequence 1: | NP_570060.1 |
Gene: | CG12206 / 31316 |
FlyBaseID: | FBgn0029662 |
Length: | 582 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_009570.1 |
Gene: | GRX7 / 852302 |
SGDID: | S000000218 |
Length: | 203 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 69 |
Identity: | 17/69 - (24%) |
Similarity: | 27/69 - (39%) |
Gaps: | 17/69 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 SNSNTEMSLKSQAAGMLLAFGDTAATAKDNLETSYDTA----------------AKSTAAPETNK 103
||::...|:.:.....|:.| |.:..|....::.:||. |:..||.|.||
Yeast 30 SNASVNESITTHHPDSLVTF-DNSGNAPGTHQSVHDTVNTQDKEAEEVDKNSGDAEFDAAAEYNK 93
Fly 104 IYPQ 107
|..|
Yeast 94 IMEQ 97
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C157344897 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.840 |
|
Return to query results.
Submit another query.