DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12206 and GRX6

DIOPT Version :9

Sequence 1:NP_570060.1 Gene:CG12206 / 31316 FlyBaseID:FBgn0029662 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_010274.1 Gene:GRX6 / 851551 SGDID:S000002168 Length:231 Species:Saccharomyces cerevisiae


Alignment Length:233 Identity:48/233 - (20%)
Similarity:86/233 - (36%) Gaps:63/233 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 KINGRPLQFET------------DGYYTFHVREHENFRSFGSN-------SSTEYEAQHFTDEQP 373
            |.|.|.|...|            ..:.|..::| |..::|.:|       ||.||.|...:....
Yeast     6 KRNARILSITTLLLLLVFFVAQNANFLTVEIKE-ETSKAFSTNMDNMAGGSSREYAAMPTSTTNK 69

  Fly   374 GEDFVGFRDIRTAGKLAGNSTIKSAKGTVRGVKNRVRNGVATFLQLQQPNVKNY-MEKDVGKVVL 437
            |...|.........|:.....|.|...::..:||...:.:.....:|    |.| :..|:..:::
Yeast    70 GSSEVDEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRITKAFNVQ----KEYSLILDLSPIII 130

  Fly   438 YTTSMGIIRDTYAKCANVKKILRTLLIKFEERDIFMSVEYQ----------------QEMRERMQ 486
            ::.|    ..:|:|  .:|::|..              |||                :|::|.::
Yeast   131 FSKS----TCSYSK--GMKELLEN--------------EYQFIPNYYIIELDKHGHGEELQEYIK 175

  Fly   487 DETIR--VPQLFVEGQLIGDANIVERLNESGELRQLLR 522
            ..|.|  ||.|.|.|...|....:::|:..|:|.:.|:
Yeast   176 LVTGRGTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQ 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12206NP_570060.1 GRX_GRX_like 434..579 CDD:239329 22/107 (21%)
GRX6NP_010274.1 GRX_GRXh_1_2_like 127..210 CDD:239511 21/102 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344895
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.