DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12206 and AT1G64500

DIOPT Version :9

Sequence 1:NP_570060.1 Gene:CG12206 / 31316 FlyBaseID:FBgn0029662 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_176631.1 Gene:AT1G64500 / 842758 AraportID:AT1G64500 Length:368 Species:Arabidopsis thaliana


Alignment Length:390 Identity:87/390 - (22%)
Similarity:153/390 - (39%) Gaps:105/390 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 DTSGQYSPCETLDSGTGSDLENHPQQQQQPQQVRSPQLELHLQTTRLMVNEEADHKHSPLETPSP 273
            |..|..:|      .|..::....:.:.:|..|:.|               |.|....|...|..
plant    65 DDDGDDAP------KTWEEVSKSLETKLKPAAVKPP---------------EVDSVKPPATPPRR 108

  Fly   274 VPKRAYSLTDDSEECDESSNSSLSCDSLHSGGLLPTTLLRDIRFRERASGPLVTKINGRPLQFET 338
            :|:::.|. ...:|.:..:..|::..       :|||:::                         
plant   109 LPRKSASF-HTLDELEVRAKRSIAAQ-------IPTTMVK------------------------- 140

  Fly   339 DGYYTFHVREHENFRSFGSNSSTEYEAQHFTDEQPGEDFVGFRDIRTAGKLAGNSTIKSAKGTVR 403
                   ::..|:.......|....|:                   |....:|..::|......|
plant   141 -------LKRTESMSKLRPESDDRTES-------------------TQSSYSGPRSVKENIFVKR 179

  Fly   404 GVKNRVRNGVATFLQLQQPNVKNYMEK---DVGK-VVLYTTSMGIIRDTYAKCANVKKILRTLLI 464
            ..:.|.:.|....:....| ::.:.||   ..|: :::||||:..:|.||..|..|:.|:....:
plant   180 DRERREKEGNKKPVMNWDP-LREFPEKCPPGGGEGLIVYTTSLQGVRRTYEDCMRVRAIMEQQGV 243

  Fly   465 KFEERDIFMSVEYQQEMRERMQDE-TIRVPQLFVEGQLIGDANIVERLNESGELRQLLRPYKSIA 528
            ..:|||:.:......|::|.:||| ::..|::||:|:.:|.|..|..:||:|:|.::|| :..:.
plant   244 VVDERDVSLDAGVLSELKELLQDEASVAPPRVFVKGRYLGGAAEVTAMNENGKLGRVLR-WARVE 307

  Fly   529 TA-----YTCQTCGGYRMLPCPACNGSKKSMHRNHFTAEFVALK------CMNCDEVGLIKCPNC 582
            ..     .||:.|||.|.|||..|.||.|       .|...|.|      |:.|:|.|||:||.|
plant   308 RVGEEGRLTCEGCGGARWLPCFECGGSCK-------VAAVGAAKGERWERCVKCNENGLIRCPVC 365

  Fly   583  582
            plant   366  365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12206NP_570060.1 GRX_GRX_like 434..579 CDD:239329 53/157 (34%)
AT1G64500NP_176631.1 GRX_GRX_like 213..362 CDD:239329 53/156 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4198
eggNOG 1 0.900 - - E1_KOG2824
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm977
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45669
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.