DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12206 and AT5G03870

DIOPT Version :9

Sequence 1:NP_570060.1 Gene:CG12206 / 31316 FlyBaseID:FBgn0029662 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_196007.1 Gene:AT5G03870 / 831685 AraportID:AT5G03870 Length:384 Species:Arabidopsis thaliana


Alignment Length:451 Identity:105/451 - (23%)
Similarity:178/451 - (39%) Gaps:127/451 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 LGKQ--ISVVKLNEGVEEMQQHMCYLVDTS---------GQYSPCETLDSGTGSDLENH--PQ-- 233
            |||:  |..:::|.|.:    |:..|..|:         .:.|| ::|:...|...|:.  |:  
plant     8 LGKKKLIREIRVNNGGD----HIVSLTSTTYGHLDLDERAETSP-KSLEVTKGEVFESEIIPRRS 67

  Fly   234 -QQQQPQQVRSPQLELHLQTTRLMVNEEADHKHS----------PLETPSPVPKRAYSLTDDSEE 287
             ::..|:.:.:.:|...|:.:..:.|.:.....|          |:::....|||..|.....:|
plant    68 IKRDDPEIINTWELMEDLEDSMHVSNPQKISPKSRGIFGKSWKTPVKSVVESPKRGSSKRFGGKE 132

  Fly   288 CDESSNSSLSCDSLHSGGLLPTTLLRDIRFRE-------RASGPLVTKINGRPLQFETDGYYTFH 345
                :||.         |:.|..:|:.....|       |.|.||.::          :...|..
plant   133 ----NNSR---------GVSPNQILKPKNILETPKRGVMRLSFPLKSE----------ESSVTVT 174

  Fly   346 VREHENFRSFGSNSSTEYEAQHFTDEQPGEDFVGFRDIRTAGKLAGNSTIKSAKGTVRGVKNRVR 410
            .|.......|..:....||.:...:::                        ..|..:..|.:..|
plant   175 QRRKSYSPMFDPDLVASYERELSQEKE------------------------QIKMVISPVVHESR 215

  Fly   411 NGVATFLQLQQPNVKNYMEKDVGK--------VVLYTTSMGIIRDTYAKCANVKKILRTLLIKFE 467
            ....|         :..:||...|        ||:|.|::..||.|:..|..|:.||.:..::|.
plant   216 KTEKT---------ERILEKFPEKCPPGGEHSVVIYITTLRGIRKTFEDCNVVRSILDSHEVRFS 271

  Fly   468 ERDIFMSVEYQQEMRERMQDETIRVPQLFVEGQLIGDANIVERLNESGELRQLLRPYKSIATA-- 530
            |||:.|...:::|:|..|..:.:::|.:||:|:::|....|.||.|.|:|..||   :.|..|  
plant   272 ERDVSMHSVFKEEIRGIMGTKHVKIPAVFVKGRMVGSVEEVMRLEEEGKLGILL---EGIPAARL 333

  Fly   531 --YTCQTCGGYRMLPCPACNGS-------KKSMHRNHFTAEFVALKCMNCDEVGLIKCPNC 582
              ..|:.|||.|.:.|..||||       ||||           :||:.|:|.||:.||.|
plant   334 GGSCCRGCGGMRFMMCVVCNGSCKVREEEKKSM-----------VKCLKCNENGLVLCPIC 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12206NP_570060.1 GRX_GRX_like 434..579 CDD:239329 55/163 (34%)
AT5G03870NP_196007.1 GRX_GRX_like 238..380 CDD:239329 54/155 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4198
eggNOG 1 0.900 - - E1_KOG2824
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm977
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45669
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.