DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12206 and CXIP1

DIOPT Version :9

Sequence 1:NP_570060.1 Gene:CG12206 / 31316 FlyBaseID:FBgn0029662 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_191050.1 Gene:CXIP1 / 824655 AraportID:AT3G54900 Length:173 Species:Arabidopsis thaliana


Alignment Length:103 Identity:32/103 - (31%)
Similarity:54/103 - (52%) Gaps:11/103 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   422 PNVKNYMEKDVG--KVVLYTTSMGIIRDTYAKCA---NVKKILRTLLIKFEERDIFMSVEYQQEM 481
            |.:|:.:||.|.  ||||:   |...|| :..|.   .|.:||:.|.:.||:.:|..:...:|.:
plant    69 PQLKDTLEKLVNSEKVVLF---MKGTRD-FPMCGFSNTVVQILKNLNVPFEDVNILENEMLRQGL 129

  Fly   482 RERMQDETIRVPQLFVEGQLIGDANIVERLNESGELRQ 519
            :|.....|.  |||::.|:..|..:|.....::|||::
plant   130 KEYSNWPTF--PQLYIGGEFFGGCDITLEAFKTGELQE 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12206NP_570060.1 GRX_GRX_like 434..579 CDD:239329 27/89 (30%)
CXIP1NP_191050.1 GRX_PICOT_like 75..164 CDD:239326 29/94 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.