DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12206 and AT3G28850

DIOPT Version :9

Sequence 1:NP_570060.1 Gene:CG12206 / 31316 FlyBaseID:FBgn0029662 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_189527.1 Gene:AT3G28850 / 822517 AraportID:AT3G28850 Length:428 Species:Arabidopsis thaliana


Alignment Length:434 Identity:99/434 - (22%)
Similarity:171/434 - (39%) Gaps:132/434 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 YLVDTSGQYSPCETLDSG----TGSDLENHPQQQQQPQQVRSPQLELHLQTTRL---MVNEEADH 263
            :|.|.|      |.|.||    ||:....:..:::..::..:.:|:..|...::   |:||:...
plant    68 HLADFS------EKLVSGESVKTGNGFGPNVVREKSDKEKSNLELQAKLMEAKVWSSMMNEKIPK 126

  Fly   264 --KHSPLETPSPVPK--RAYSLTDDSEECDESSNS-----SLSCDSLHSGG-----LLPTTLLRD 314
              ..:|:.||...|:  ..:.:.|..|:......|     |.|.|...:||     :.|..|   
plant   127 IVPKTPIVTPPGEPETINTWEMMDGLEDVLSPLRSPNHVKSFSFDVGPNGGKSNGSVKPVWL--- 188

  Fly   315 IRFRERASG-----PLVTKINGRPLQFETDGYYTFHVREHENFRSFGSNSSTEYEAQ---HFTDE 371
             :..|...|     |.:.....:.|| |....:.||:..|            ::|.:   :|:||
plant   189 -QMEEEEEGFEDFDPEIISSFRKSLQ-ELPSDHPFHISNH------------DFELKPRFNFSDE 239

  Fly   372 QPGEDFVGFRDIRTAGKLAGNSTIKSAKGTVRGVKNRVRNGVATFLQLQQPNVKNYMEKDVGK-- 434
            :..|:                                                    |:.|||  
plant   240 EKEEE----------------------------------------------------EQSVGKER 252

  Fly   435 VVLYTTSMGIIRDTYAKCANVKKILRTLLIKFEERDIFMSVEYQQEMRERMQDE-----TIRVPQ 494
            |:||.||:..||.||.:..:|:.||::|.|:.:|||:.|...::.|::|.:.::     .|.:|:
plant   253 VILYFTSLRGIRKTYEESCDVRVILKSLGIRVDERDVSMHSGFKDELKELLGEKFNKGVGITLPR 317

  Fly   495 LFVEGQLIGDANIVERLNESGELRQLLRPYKSI-----ATAYTCQTCGGYRMLPCPACNGSKKSM 554
            :|:..:.||.|..:.:|||.|:|.:||...:.:     .....|:.||..|.:||..|:||.|..
plant   318 VFLGRKYIGGAEEIRKLNEDGKLEKLLGGCERVEENQNGNGLECEACGDVRFVPCETCSGSCKVY 382

  Fly   555 HRNH----------------FTAEFVALKCMNCDEVGLIKCPNC 582
            :...                ...|:....|.:|:|.|||:||.|
plant   383 YEYEDDDDDDDEGDDDESVKEEREYGFQTCPDCNENGLIRCPVC 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12206NP_570060.1 GRX_GRX_like 434..579 CDD:239329 51/172 (30%)
AT3G28850NP_189527.1 GRX_GRX_like 252..423 CDD:239329 50/170 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3655
eggNOG 1 0.900 - - E1_KOG2824
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm977
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.