DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12206 and CXIP2

DIOPT Version :9

Sequence 1:NP_570060.1 Gene:CG12206 / 31316 FlyBaseID:FBgn0029662 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_565885.1 Gene:CXIP2 / 818407 AraportID:AT2G38270 Length:293 Species:Arabidopsis thaliana


Alignment Length:286 Identity:64/286 - (22%)
Similarity:114/286 - (39%) Gaps:64/286 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 TPS-PVPKRAYSLTDDSEECDESSNSSLSCDSLHSGGLLPTTLLRDIRFRERASGPLVTKINGRP 333
            ||| ..|..:::|.|.:.....|...:.:..||....|||                 :|:.:..|
plant    37 TPSFSFPSLSFTLRDTAPSRRRSFFIASAVKSLTETELLP-----------------ITEADSIP 84

  Fly   334 LQFETDGYYTFHVREHE-NFRSFGSNSSTEYEAQHF--TDEQPGEDFVGF--------------- 380
               ...|.|..:.:..| .|.....|.:....| |.  ..|..|...||.               
plant    85 ---SASGVYAVYDKSDELQFVGISRNIAASVSA-HLKSVPELCGSVKVGIVEEPDKAVLTQAWKL 145

  Fly   381 ---RDIRTAGKL-----AGNSTIKSAKGTVRGVKNRVRNGVATFLQLQQPNVKNYMEKDVGKVVL 437
               ..|:..||:     :||:|.  .|.|.| .|:.:|......::|..|     :|:.:.::|.
plant   146 WIEEHIKVTGKVPPGNKSGNNTF--VKQTPR-KKSDIRLTPGRHVELTVP-----LEELIDRLVK 202

  Fly   438 YTTSMGIIRDTYA--KCA---NVKKILRTLLIKFEERDIFMSVEYQQEMRERMQDET--IRVPQL 495
            .:..:..|:.:.:  :|.   .|..||.:..:.:|..|: :..||...:||.:::.:  ...||:
plant   203 ESKVVAFIKGSRSAPQCGFSQRVVGILESQGVDYETVDV-LDDEYNHGLRETLKNYSNWPTFPQI 266

  Fly   496 FVEGQLIGDANIVERLNESGELRQLL 521
            ||:|:|:|..:|:..:.|:|||..:|
plant   267 FVKGELVGGCDILTSMYENGELANIL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12206NP_570060.1 GRX_GRX_like 434..579 CDD:239329 25/95 (26%)
CXIP2NP_565885.1 GIY-YIG_AtGrxS16 88..161 CDD:198404 14/73 (19%)
GRX_PICOT_like 197..289 CDD:239326 23/92 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.