DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12206 and Glrx2

DIOPT Version :9

Sequence 1:NP_570060.1 Gene:CG12206 / 31316 FlyBaseID:FBgn0029662 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001033681.1 Gene:Glrx2 / 69367 MGIID:1916617 Length:156 Species:Mus musculus


Alignment Length:148 Identity:35/148 - (23%)
Similarity:69/148 - (46%) Gaps:17/148 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 VGFRDIRTAGKLAGNSTIKSAKGTVRGVKNRVRNGVATFLQLQQPNVKNYMEKDVGK--VVLYTT 440
            ||.|.:.:...|||......|.|:..|      |..::|.........|.:::.:..  ||::: 
Mouse     9 VGRRLVASGRILAGRRGAAGAAGSGMG------NSTSSFWGKSTTTPVNQIQETISNNCVVIFS- 66

  Fly   441 SMGIIRDTYAKCANVKKILRTLLIKFEERDIFMSVEYQQEMRERMQDET--IRVPQLFVEGQLIG 503
                 :.:.:.|:..|||...:.:.::..::.| :||..:.::.:...|  ..||::||.|:.||
Mouse    67 -----KTSCSYCSMAKKIFHDMNVNYKAVELDM-LEYGNQFQDALHKMTGERTVPRIFVNGRFIG 125

  Fly   504 DANIVERLNESGELRQLL 521
            .|....||::.|:|..|:
Mouse   126 GAADTHRLHKEGKLLPLV 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12206NP_570060.1 GRX_GRX_like 434..579 CDD:239329 23/92 (25%)
Glrx2NP_001033681.1 GRX_GRXh_1_2_like 61..142 CDD:239511 22/87 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.