DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12206 and Grxcr2

DIOPT Version :9

Sequence 1:NP_570060.1 Gene:CG12206 / 31316 FlyBaseID:FBgn0029662 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001178007.1 Gene:Grxcr2 / 681048 RGDID:1584696 Length:248 Species:Rattus norvegicus


Alignment Length:290 Identity:70/290 - (24%)
Similarity:110/290 - (37%) Gaps:80/290 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 RDIRFRERASGPLVTKINGRPLQ--FETDGYYTFHVREHENFRSFGSNSSTEYEAQH-FTDE--Q 372
            |.:||:      :.:..:||.|:  || ||      :|.|         |.:.|..| |..|  :
  Rat    17 RKVRFK------ISSSYSGRVLKQVFE-DG------QELE---------SPKEEYPHSFLQEALE 59

  Fly   373 PGEDFVGFRDIRTAGKLAGNSTIKSAKGTVRGVKNRVRNGVATFLQLQQPNVKNYMEK------- 430
            |.:...|..::       ....:.|.|.|.:.: :..|:..|..|...||...:|...       
  Rat    60 PMDGVYGSGEV-------PKPQLYSPKLTAQRI-SVFRDSSAYTLAGSQPLFNDYKANDHKPPPI 116

  Fly   431 -DVGKVVLYTTSMGIIRDTYAKCANVKKILRTLLIKFEERDIFMSVEYQQEMRERMQDETIRVPQ 494
             |.||:::||.::              ||:||   ..::||....:..::|:.|.        ..
  Rat   117 IDFGKIIIYTNNL--------------KIIRT---PMDKRDFMRKILQKEEVAEE--------ES 156

  Fly   495 LFVEGQLIGDANIVERLNESGELRQLLRPY-------KSIATAYTCQTCGGYRMLPCPACNGSKK 552
            |.:.|:..||     |...|..|.:..|.:       ..:.....|..|.|..:..|..|:|||.
  Rat   157 LMITGENDGD-----REQNSSPLPETDRTFLHSQHTQDGLVPEDNCLHCQGSGIATCSLCHGSKF 216

  Fly   553 SMHRNHFTAEFVALKCMNCDEVGLIKCPNC 582
            ||..|.|...:.||:|..|:|.||..|..|
  Rat   217 SMLANRFKESYRALRCPACNENGLQPCRIC 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12206NP_570060.1 GRX_GRX_like 434..579 CDD:239329 38/151 (25%)
Grxcr2NP_001178007.1 Thioredoxin_like <197..243 CDD:412351 19/45 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346544
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2824
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.