DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12206 and GRXCR2

DIOPT Version :9

Sequence 1:NP_570060.1 Gene:CG12206 / 31316 FlyBaseID:FBgn0029662 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001073985.1 Gene:GRXCR2 / 643226 HGNCID:33862 Length:248 Species:Homo sapiens


Alignment Length:285 Identity:71/285 - (24%)
Similarity:109/285 - (38%) Gaps:79/285 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 KINGRP--LQFETDGYYTFHVREHENFRSFGSNSSTEYEAQHFTD----EQPGEDFV-GF--RDI 383
            |.:|:|  ::|:....|:..|.:                 |.|.|    |.|.|::. .|  ..:
Human    11 KSDGKPRKVRFKISSSYSGRVLK-----------------QVFEDGQELESPKEEYPHSFLQESL 58

  Fly   384 RTAGKLAGNSTIK-----SAKGTVRGVKNRVRNGVATFLQLQQPNVKNYMEK--------DVGKV 435
            .|...:.|:..:.     |.|.|.:.: :..|.|.|..|...||...:|...        |.||:
Human    59 ETMDGVYGSGEVPRPQMCSPKLTAQRI-SVFREGNAYTLAGGQPRFNDYKANDHKPLPIIDFGKI 122

  Fly   436 VLYTTSMGIIRDTYAKCANVKKILRTLLIKFEERDIFMSVEYQQEMRERMQDETIRVPQLFVEGQ 500
            ::||.::.|||....|...|:|||                  |:|  |..::|::...:....|:
Human   123 IIYTNNLKIIRTPMDKRDFVRKIL------------------QKE--EEAEEESLMNKEESYGGR 167

  Fly   501 LIGDANIVE--------RLNESGELRQLLRPYKSIATAYTCQTCGGYRMLPCPACNGSKKSMHRN 557
            ...|..:||        |..:.|::     |..|      |..|.|.....|..|:|||.||..|
Human   168 DQHDRPLVEAESTLPQNRYTQEGDI-----PEDS------CFHCRGSGSATCSLCHGSKFSMLAN 221

  Fly   558 HFTAEFVALKCMNCDEVGLIKCPNC 582
            .|...:.||:|..|:|.||..|..|
Human   222 RFKESYRALRCPACNENGLQPCQIC 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12206NP_570060.1 GRX_GRX_like 434..579 CDD:239329 42/152 (28%)
GRXCR2NP_001073985.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 3/8 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..172 3/21 (14%)
Thioredoxin_like <197..243 CDD:294274 19/45 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152955
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2824
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.700

Return to query results.
Submit another query.