DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12206 and Grxcr1

DIOPT Version :9

Sequence 1:NP_570060.1 Gene:CG12206 / 31316 FlyBaseID:FBgn0029662 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001178864.1 Gene:Grxcr1 / 498355 RGDID:1564635 Length:290 Species:Rattus norvegicus


Alignment Length:311 Identity:100/311 - (32%)
Similarity:158/311 - (50%) Gaps:46/311 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 ECDESSNSSLSCDSLHSGGLLPTTLLRDIRFRERASGPL------VTKINGRPLQFETDGYYTFH 345
            |.|..........|.|||     .:|:::....:|.|.|      |..|:|..   :::|:...|
  Rat     9 ESDRPRKVRFRIASSHSG-----RVLKEVYEDGQAPGSLDSECASVCAIDGLS---DSEGHQNGH 65

  Fly   346 VREHENFRSFGSNSSTEYEAQHFTDEQPGEDFVGFRDIRTAGKLAGNS---TIKSAKGTVRGVKN 407
            :...:|                  :::..:|.: ....|||.:.|..:   .|.|..|||||||.
  Rat    66 IGLEDN------------------EQEKDQDNL-LVLARTASEKAFGTRRVNILSKNGTVRGVKY 111

  Fly   408 RVRNGVATFLQ----LQQPNVKNYMEKDVGKVVLYTTSMGIIRDTYAKCANVKKILRTLLIKFEE 468
            :|..|.|.|..    ||||:.    :.:..:||:|||.:.::|.|:.:|..|:||.:...:||||
  Rat   112 KVSAGQALFNNLTKVLQQPSA----DLEFDRVVIYTTCLRVVRTTFERCELVRKIFQNHRVKFEE 172

  Fly   469 RDIFMSVEYQQEMRERMQ--DETIRVPQLFVEGQLIGDANIVERLNESGELRQLLRPYKSIATAY 531
            ::|.::.:|.:|:.||.:  .|...:|.:|::|..:|.|..:..:||||||:.||...:.:...:
  Rat   173 KNIALNGDYGKELDERCRRVSEAPSLPVVFIDGHYLGGAEKILSMNESGELQDLLTKIERVQHPH 237

  Fly   532 TCQTCGGYRMLPCPACNGSKKSMHRNHFTAEFVALKCMNCDEVGLIKCPNC 582
            .|.:|||:..|||..|:|||.|:.||.||..|.||||..|:|.||.:|.||
  Rat   238 ECPSCGGFGFLPCSVCHGSKMSVFRNCFTDAFKALKCTACNENGLQRCKNC 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12206NP_570060.1 GRX_GRX_like 434..579 CDD:239329 59/146 (40%)
Grxcr1NP_001178864.1 GRX_GRX_like 138..285 CDD:239329 59/146 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346542
Domainoid 1 1.000 87 1.000 Domainoid score I7828
eggNOG 1 0.900 - - E1_KOG2824
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002612
OrthoInspector 1 1.000 - - otm45526
orthoMCL 1 0.900 - - OOG6_104403
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1599
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.600

Return to query results.
Submit another query.