DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12206 and CG31559

DIOPT Version :9

Sequence 1:NP_570060.1 Gene:CG12206 / 31316 FlyBaseID:FBgn0029662 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_731045.1 Gene:CG31559 / 40749 FlyBaseID:FBgn0051559 Length:454 Species:Drosophila melanogaster


Alignment Length:487 Identity:227/487 - (46%)
Similarity:265/487 - (54%) Gaps:163/487 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 VDTSGQYSP-CETLDSGTGSDLENHPQQQQQPQQVRSPQLELHLQTTRLMVNEEADHKHSPLETP 271
            :|...||:. |||.|||.|||||:                                         
  Fly    19 MDQYQQYAAHCETADSGNGSDLES----------------------------------------- 42

  Fly   272 SPVPKRAYSLTDDSEECDESSNSSLSCDSLHS--------------------------GGLLPTT 310
            :.:|.:    .||||   ||..|||..||:|.                          |.|||.:
  Fly    43 TGLPTK----PDDSE---ESGPSSLGSDSMHGSSTEYVRQSASQPSGQRQRQKSLRVLGALLPDS 100

  Fly   311 LLRDIRFR--------------------------------------------------ERA---- 321
            ||||||.|                                                  |||    
  Fly   101 LLRDIRDRRSTEYVVQFSQPEDEEKIQVPDKIPEKPSPFRLARESLSEDKIEELRAAVERANFVQ 165

  Fly   322 --------------SGPLVTKINGR----PLQFETDGYYTFHVREHENFRSFGSNSSTEYEAQHF 368
                          |.|..:.|.|.    ..::..|.||:||:.|||||.:..:.|..  ||.|.
  Fly   166 TGEETLDSIDATSQSLPASSNIGGHRGNINYKYADDQYYSFHINEHENFGARSARSGD--EADHS 228

  Fly   369 T--DEQPGED----------FVGFRDIRTAGKLAGNSTIKSAKGTVRGVKNRVRNGVATFLQL-Q 420
            |  ..:.|.|          |.|:||:| .|..:..|||:||||||||||||||||:|||||| |
  Fly   229 TGAGSEAGSDSGILTEQQDLFAGYRDVR-CGASSTQSTIRSAKGTVRGVKNRVRNGIATFLQLQQ 292

  Fly   421 QPNVKNYMEKDVGKVVLYTTSMGIIRDTYAKCANVKKILRTLLIKFEERDIFMSVEYQQEMRERM 485
            |||.||:.|||:||||||||||||||:||.||||||:||||||:||||||:|||||||.|||:||
  Fly   293 QPNAKNFKEKDLGKVVLYTTSMGIIRETYTKCANVKQILRTLLVKFEERDVFMSVEYQAEMRQRM 357

  Fly   486 QDETIRVPQLFVEGQLIGDANIVERLNESGELRQLLRPYKSIATAYTCQTCGGYRMLPCPACNGS 550
            |...:|||||:||||.||||..|||:||||||||||:||||:|:.||||||||||:||||:||||
  Fly   358 QSGQVRVPQLYVEGQHIGDAETVERMNESGELRQLLKPYKSMASTYTCQTCGGYRLLPCPSCNGS 422

  Fly   551 KKSMHRNHFTAEFVALKCMNCDEVGLIKCPNC 582
            |||:||||||||||||||||||||||:||.||
  Fly   423 KKSVHRNHFTAEFVALKCMNCDEVGLVKCHNC 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12206NP_570060.1 GRX_GRX_like 434..579 CDD:239329 120/144 (83%)
CG31559NP_731045.1 GRX_GRX_like 306..451 CDD:239329 120/144 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444263
Domainoid 1 1.000 64 1.000 Domainoid score I3655
eggNOG 1 0.900 - - E1_KOG2824
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4257
Isobase 1 0.950 - 0 Normalized mean entropy S12299
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002612
OrthoInspector 1 1.000 - - otm26471
orthoMCL 1 0.900 - - OOG6_104403
Panther 1 1.100 - - P PTHR45669
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4282
SonicParanoid 1 1.000 - - X1599
1211.770

Return to query results.
Submit another query.