DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12206 and GRXCR1

DIOPT Version :9

Sequence 1:NP_570060.1 Gene:CG12206 / 31316 FlyBaseID:FBgn0029662 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001073945.1 Gene:GRXCR1 / 389207 HGNCID:31673 Length:290 Species:Homo sapiens


Alignment Length:308 Identity:100/308 - (32%)
Similarity:153/308 - (49%) Gaps:40/308 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 ECDESSNSSLSCDSLHSGGLLPTTLLRDIRFRERASGPL------VTKINGRPLQFETDGYYTFH 345
            |.|..........|.|||     .:|:::....:.||.|      :..|:|..   ::||....|
Human     9 ESDRPRKVRFRIASSHSG-----RVLKEVYEDGQPSGSLDSECASICGIDGLG---DSDGQQNGH 65

  Fly   346 VREHENFRSFGSNSSTEYEAQHFTDEQPGEDFVGFRDIRTAGKLAGNSTIKSAKGTVRGVKNRVR 410
            :      .|.|..:..:.::.........|...|.|.:          .|.|..|||||||.:|.
Human    66 I------ESEGDENENDQDSLLVLARAASEKGFGTRRV----------NILSKNGTVRGVKYKVS 114

  Fly   411 NGVATFLQ----LQQPNVKNYMEKDVGKVVLYTTSMGIIRDTYAKCANVKKILRTLLIKFEERDI 471
            .|.|.|..    ||||:.    :.:..:||:|||.:.::|.|:.:|..|:||.:...:||||::|
Human   115 AGQALFNNLTKVLQQPST----DLEFDRVVIYTTCLRVVRTTFERCELVRKIFQNHRVKFEEKNI 175

  Fly   472 FMSVEYQQEMRERMQ--DETIRVPQLFVEGQLIGDANIVERLNESGELRQLLRPYKSIATAYTCQ 534
            .::.||.:|:.||.:  .|...:|.:|::|..:|.|..:..:||||||:.:|...:.:...:.|.
Human   176 ALNGEYGKELDERCRRVSEAPSLPVVFIDGHYLGGAEKILSMNESGELQDILTKIERVQHPHECP 240

  Fly   535 TCGGYRMLPCPACNGSKKSMHRNHFTAEFVALKCMNCDEVGLIKCPNC 582
            :|||:..|||..|:|||.||.||.||..|.||||..|:|.||.:|.||
Human   241 SCGGFGFLPCSVCHGSKMSMFRNCFTDSFKALKCTACNENGLQRCKNC 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12206NP_570060.1 GRX_GRX_like 434..579 CDD:239329 60/146 (41%)
GRXCR1NP_001073945.1 GRX_GRX_like 138..285 CDD:239329 60/146 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152953
Domainoid 1 1.000 86 1.000 Domainoid score I8087
eggNOG 1 0.900 - - E1_KOG2824
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002612
OrthoInspector 1 1.000 - - otm41410
orthoMCL 1 0.900 - - OOG6_104403
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4282
SonicParanoid 1 1.000 - - X1599
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.630

Return to query results.
Submit another query.