DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12206 and AT3G11773

DIOPT Version :10

Sequence 1:NP_570060.1 Gene:CG12206 / 31316 FlyBaseID:FBgn0029662 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001189861.1 Gene:AT3G11773 / 3768829 AraportID:AT3G11773 Length:200 Species:Arabidopsis thaliana


Alignment Length:118 Identity:46/118 - (38%)
Similarity:67/118 - (56%) Gaps:9/118 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   466 FEERDIFMSVEYQQEMRERMQDETIRVPQLFVEGQLIGDANIVERLNESGELRQLLRPYKSIATA 530
            |.|||:.|..||::|| .|:..|.:..|:||::.:.||.|:.|..|||:.:|::||..:.| |.:
plant    90 FRERDVSMDCEYKEEM-WRLLGEQVTPPRLFIKCKYIGGADEVVSLNENEKLKKLLEVFSS-AKS 152

  Fly   531 YTCQTCGGYRMLPCPACNGSKKSMHRNHFTAEFVALK-CMNCDEVGLIKCPNC 582
            ..|:.|...|.|.|..|||      |:...||....| |:.|:|.||:||..|
plant   153 RQCEMCENERFLICSKCNG------RSRVVAEHETWKRCIECNENGLVKCALC 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12206NP_570060.1 GRX_GRX_like 434..579 CDD:239329 43/113 (38%)
AT3G11773NP_001189861.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 85..196 CDD:469754 43/113 (38%)

Return to query results.
Submit another query.