DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12206 and AT3G11773

DIOPT Version :9

Sequence 1:NP_570060.1 Gene:CG12206 / 31316 FlyBaseID:FBgn0029662 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001189861.1 Gene:AT3G11773 / 3768829 AraportID:AT3G11773 Length:200 Species:Arabidopsis thaliana


Alignment Length:118 Identity:46/118 - (38%)
Similarity:67/118 - (56%) Gaps:9/118 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   466 FEERDIFMSVEYQQEMRERMQDETIRVPQLFVEGQLIGDANIVERLNESGELRQLLRPYKSIATA 530
            |.|||:.|..||::|| .|:..|.:..|:||::.:.||.|:.|..|||:.:|::||..:.| |.:
plant    90 FRERDVSMDCEYKEEM-WRLLGEQVTPPRLFIKCKYIGGADEVVSLNENEKLKKLLEVFSS-AKS 152

  Fly   531 YTCQTCGGYRMLPCPACNGSKKSMHRNHFTAEFVALK-CMNCDEVGLIKCPNC 582
            ..|:.|...|.|.|..|||      |:...||....| |:.|:|.||:||..|
plant   153 RQCEMCENERFLICSKCNG------RSRVVAEHETWKRCIECNENGLVKCALC 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12206NP_570060.1 GRX_GRX_like 434..579 CDD:239329 43/113 (38%)
AT3G11773NP_001189861.1 Thioredoxin_like 85..196 CDD:294274 43/113 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3655
eggNOG 1 0.900 - - E1_KOG2824
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002612
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104403
Panther 1 1.100 - - O PTHR45669
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1599
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.