DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12206 and Grx1t

DIOPT Version :9

Sequence 1:NP_570060.1 Gene:CG12206 / 31316 FlyBaseID:FBgn0029662 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_611609.1 Gene:Grx1t / 37483 FlyBaseID:FBgn0034658 Length:116 Species:Drosophila melanogaster


Alignment Length:117 Identity:31/117 - (26%)
Similarity:54/117 - (46%) Gaps:27/117 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   419 LQQPNVKNYMEKDV------------GKVVLYTTS----MGIIRDTYAKCANVKKILRTLLIKFE 467
            ||:|.:  |:..|.            .|||:::.|    ..:.::.:.| .|||    ..:|:.:
  Fly     8 LQRPTL--YVSMDSSHAQFVRDTISGNKVVIFSKSYCPYCSMAKEQFRK-INVK----ATVIELD 65

  Fly   468 ERDIFMSVEYQQEMRERMQDETIRVPQLFVEGQLIGDANIVERLNESGELRQ 519
            :||  ...|.|..:.|.....|  ||:.|::|:.:|....|:||.|.|.|::
  Fly    66 QRD--DGNEIQAVLGEMTGSRT--VPRCFIDGKFVGGGTDVKRLYEQGILQK 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12206NP_570060.1 GRX_GRX_like 434..579 CDD:239329 26/90 (29%)
Grx1tNP_611609.1 GRX_GRXh_1_2_like 33..113 CDD:239511 26/88 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457830
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.