DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12206 and Grxcr2

DIOPT Version :9

Sequence 1:NP_570060.1 Gene:CG12206 / 31316 FlyBaseID:FBgn0029662 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001028598.1 Gene:Grxcr2 / 332309 MGIID:2685697 Length:254 Species:Mus musculus


Alignment Length:187 Identity:48/187 - (25%)
Similarity:72/187 - (38%) Gaps:37/187 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 RNGVATFLQLQQPNVKNYMEK--------DVGKVVLYTTSMGIIRDTYAKCANVKKILRTLLIKF 466
            |:..|..|...||...:|...        |.||:::||.::.|||....|...::|||:...:. 
Mouse    89 RDSGAYTLAGSQPLFNDYKANDHKPPPIIDFGKIIIYTNNLKIIRTPMDKRDFMRKILQKEDVA- 152

  Fly   467 EERDIFMSVEYQQE------MRERMQDETIRVPQLFVEGQLIGDANIVERLNESGELRQLLRPYK 525
            ||..:.::.|...:      :.||.........:.|:..|...|..:.|                
Mouse   153 EEASLMITGENDGDREQGCPLPERNGSPLPESERTFLHSQHTQDGLVPE---------------- 201

  Fly   526 SIATAYTCQTCGGYRMLPCPACNGSKKSMHRNHFTAEFVALKCMNCDEVGLIKCPNC 582
                  .|..|.|..:..|..|:|||.||..|.|...:.||:|..|:|.||..|..|
Mouse   202 ------DCLHCQGSGIATCSLCHGSKFSMLANRFKESYRALRCPACNENGLQPCRIC 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12206NP_570060.1 GRX_GRX_like 434..579 CDD:239329 38/150 (25%)
Grxcr2NP_001028598.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..183 3/21 (14%)
Thioredoxin_like <200..249 CDD:294274 20/70 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843039
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2824
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.