DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12206 and F10D7.3

DIOPT Version :9

Sequence 1:NP_570060.1 Gene:CG12206 / 31316 FlyBaseID:FBgn0029662 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_510815.2 Gene:F10D7.3 / 181766 WormBaseID:WBGene00017340 Length:146 Species:Caenorhabditis elegans


Alignment Length:141 Identity:35/141 - (24%)
Similarity:60/141 - (42%) Gaps:35/141 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 KSAKGTVRGVKNRVRNGVATFLQLQQPNVKNYMEKDVGKVVLYTTSMGIIRDTYAKCANVKKILR 460
            |....|::.:::::.|.|.|.                 ||::|:       .||...:   |.|:
 Worm    24 KKEDKTLKDLEDKIVNDVMTH-----------------KVMVYS-------KTYCPWS---KRLK 61

  Fly   461 TLLIKFE-------ERDIFMSVEYQQEMRERMQDETIRVPQLFVEGQLIGDANIVERLNESGELR 518
            .:|..:|       |.|.....|..||:.::....| .|||||:.|:.:|..:..:.:.|.||||
 Worm    62 AILANYEIDDMKIVELDRSNQTEEMQEILKKYSGRT-TVPQLFISGKFVGGHDETKAIEEKGELR 125

  Fly   519 QLLRPYKSIAT 529
            .||....::.|
 Worm   126 PLLEKAHALFT 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12206NP_570060.1 GRX_GRX_like 434..579 CDD:239329 30/103 (29%)
F10D7.3NP_510815.2 GRX_euk 46..128 CDD:274016 26/92 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.