DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12206 and GLRX3

DIOPT Version :9

Sequence 1:NP_570060.1 Gene:CG12206 / 31316 FlyBaseID:FBgn0029662 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001186797.1 Gene:GLRX3 / 10539 HGNCID:15987 Length:335 Species:Homo sapiens


Alignment Length:413 Identity:84/413 - (20%)
Similarity:145/413 - (35%) Gaps:125/413 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 AASQAAATAADTAATLQHNNTVKIQIES------------QGQQRT-----LGK---QISVVKLN 194
            ||..|.|...:..:..|....::::.:|            |..|..     |.|   |:|.|||.
Human     5 AAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLE 69

  Fly   195 -EGVEEMQQHMCYLVDTSGQYSPCETLDSGTGSDLENHPQQQQQPQQVRSPQLELHLQTTRLMVN 258
             |||.|:          |.:|                         ::.|....|..:.::.:  
Human    70 AEGVPEV----------SEKY-------------------------EISSVPTFLFFKNSQKI-- 97

  Fly   259 EEADHKHSPLETPSPVPKRAYSLTDDSEECDESSNSSLSCDSLHSGGLLPTT---LLRDIRFRER 320
            :..|..|:| |....|.:.|                       .||..||:.   |..|:..|.:
Human    98 DRLDGAHAP-ELTKKVQRHA-----------------------SSGSFLPSANEHLKEDLNLRLK 138

  Fly   321 A---SGPLVTKINGRPLQ----FETDGYYTFHVREHENFRSFGSNSSTEYEAQHFTDEQPGEDFV 378
            .   :.|.:..:.|.|.:    |........| :.:..|.||          ..|:||:..:...
Human   139 KLTHAAPCMLFMKGTPQEPRCGFSKQMVEILH-KHNIQFSSF----------DIFSDEEVRQGLK 192

  Fly   379 GFR------DIRTAGKLAGNSTIKSAKGTVRGVKNRVRNGVATFLQLQQPNVKNYMEKDVGKVVL 437
            .:.      .:..:|:|.|...|         :|....:.....:..:.|.::..::....|..:
Human   193 AYSSWPTYPQLYVSGELIGGLDI---------IKELEASEELDTICPKAPKLEERLKVLTNKASV 248

  Fly   438 YTTSMGIIRDTYAKCANVKKILRTLL---IKFEERDIFMSVEYQQEMRERMQDETIRVPQLFVEG 499
            .....|..::  |||...|:||..|.   :::|..||....|.:|.::......|  .|||:|:|
Human   249 MLFMKGNKQE--AKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPT--YPQLYVKG 309

  Fly   500 QLIGDANIVERLNESGELRQLLR 522
            :|:|..:||:.|.|:|||..:||
Human   310 ELVGGLDIVKELKENGELLPILR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12206NP_570060.1 GRX_GRX_like 434..579 CDD:239329 31/92 (34%)
GLRX3NP_001186797.1 TRX_PICOT 18..113 CDD:239282 23/132 (17%)
GRX_PICOT_like 137..225 CDD:239326 16/107 (15%)
GRX_PICOT_like 239..327 CDD:239326 27/91 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.