DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12206 and grxcr1

DIOPT Version :9

Sequence 1:NP_570060.1 Gene:CG12206 / 31316 FlyBaseID:FBgn0029662 Length:582 Species:Drosophila melanogaster
Sequence 2:XP_012811628.1 Gene:grxcr1 / 100489785 XenbaseID:XB-GENE-6042490 Length:306 Species:Xenopus tropicalis


Alignment Length:296 Identity:97/296 - (32%)
Similarity:154/296 - (52%) Gaps:48/296 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 RDIRFRERASGPLVTKINGRPL-QFETDGYYTFHVREHENFRSFGSNSS---------------- 360
            |.:|||..:|.      :||.| :..|||         ::..|..::||                
 Frog    31 RKVRFRVASSH------SGRVLREVYTDG---------DSLDSECASSSETDQNSVPSESDGAQN 80

  Fly   361 ----TEYEAQHFTDEQPGEDFVGFRDIRTAGKLAGNSTIKSAKGTVRGVKNRVRNGVATFLQLQ- 420
                :|::.   ::.:|.:..|..|..:..|.......|.|..|||||||::|..|.|.|..|. 
 Frog    81 GFLGSEFDE---SENEPDDLLVLARATKDRGFATKRVNILSKNGTVRGVKHKVSAGQALFDNLAK 142

  Fly   421 --QPNVKNYMEKDVGKVVLYTTSMGIIRDTYAKCANVKKILRTLLIKFEERDIFMSVEYQQEMRE 483
              ||:.    ..:.|::|:||||:.::|:|:.:|..|:||.:...:||||::|.::.::.:|:.|
 Frog   143 VFQPST----TLEYGRIVIYTTSLRVVRNTFERCEMVRKIFQNHRVKFEEKNIALNGDFGKELDE 203

  Fly   484 RMQ--DETIRVPQLFVEGQLIGDANIVERLNESGELRQLLRPYKSIATAYTCQTCGGYRMLPCPA 546
            |.:  .|...:|.:|::|..:|.|..:..:||||||:.||...:.:...:.|..|||:..|||..
 Frog   204 RCRRVSEVPSLPVVFIDGHYLGGAEKILAMNESGELQDLLMKIERVQHPHACAFCGGFGFLPCLV 268

  Fly   547 CNGSKKSMHRNHFTAEFVALKCMNCDEVGLIKCPNC 582
            |:|||.|:.||.||..|.||||..|:|.||.:|.||
 Frog   269 CHGSKMSVFRNCFTDSFKALKCTACNENGLQRCKNC 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12206NP_570060.1 GRX_GRX_like 434..579 CDD:239329 58/146 (40%)
grxcr1XP_012811628.1 GRX_GRX_like 154..301 CDD:239329 58/146 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I7976
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I4229
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002612
OrthoInspector 1 1.000 - - otm48618
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1599
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.