DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16781 and march5

DIOPT Version :9

Sequence 1:NP_001259211.1 Gene:CG16781 / 31315 FlyBaseID:FBgn0029661 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001076296.1 Gene:march5 / 561952 ZFINID:ZDB-GENE-070424-47 Length:281 Species:Danio rerio


Alignment Length:292 Identity:123/292 - (42%)
Similarity:170/292 - (58%) Gaps:34/292 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ERICWICFATSEDNPHAHWVQPCQCRGDTKWVHQSCLYRWIDEKQLGDRRQTVICQQCQTEYIMV 105
            :|.||:||||.||:..|.||:||:|||.|||||||||.||:||||.|:....|.|.||..||::|
Zfish    14 DRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQSCLQRWVDEKQRGNSTARVACPQCNAEYLIV 78

  Fly   106 FPQMNPIARVLEKLDYAVRRICPFLVLGMFLCCIYWIALTYGAFTIIQVVGQDRAMQLME--NKV 168
            ||::.|:..||:..|..:.:.|||...|:.:..|||.|:||||.|::||||....:.:||  :.:
Zfish    79 FPKLGPVVYVLDLADRLISKACPFAAAGIMVGSIYWTAVTYGAVTVMQVVGHKEGLDVMERADPL 143

  Fly   169 ILLVGLPFIPVGLILFRLVRWKDAVLKAMRSIYIYIPRKLPFFHRTNQSEGASRDLGDLGDLDDL 233
            .||:|||.|||.|||.:::||:|.||:..|.    ...||...:......|.             
Zfish   144 FLLIGLPTIPVMLILGKMIRWEDYVLRLWRK----YSNKLQILNSIFPGIGC------------- 191

  Fly   234 SVSSSSSISLPPIQHNPSITEPF--YIS--RLICGAFFLPTFATTVGNVFFGRLDDALQRTILGG 294
                       |:...|:...|.  ::|  |::|||...||.||.||.:.|..::..||||||||
Zfish   192 -----------PVPRIPAEASPLADHVSATRILCGALVFPTIATIVGKLMFSSVNSNLQRTILGG 245

  Fly   295 IAYIGIKGLLKMYLDQKLYLRRLGRCILNYTD 326
            ||::.|||..|:|..|:.|||:..|.|||:.:
Zfish   246 IAFVAIKGAFKVYFKQQQYLRQAHRKILNFPE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16781NP_001259211.1 RINGv 43..99 CDD:128983 35/55 (64%)
march5NP_001076296.1 RINGv 17..72 CDD:128983 35/54 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588160
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1210654at2759
OrthoFinder 1 1.000 - - FOG0003968
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104806
Panther 1 1.100 - - O PTHR46283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.