DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16781 and MARCHF5

DIOPT Version :9

Sequence 1:NP_001259211.1 Gene:CG16781 / 31315 FlyBaseID:FBgn0029661 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_060294.1 Gene:MARCHF5 / 54708 HGNCID:26025 Length:278 Species:Homo sapiens


Alignment Length:291 Identity:123/291 - (42%)
Similarity:173/291 - (59%) Gaps:30/291 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ERICWICFATSEDNPHAHWVQPCQCRGDTKWVHQSCLYRWIDEKQLGDRRQTVICQQCQTEYIMV 105
            :|.||:||||.||:..|.||:||:|||.||||||:||.||:||||.|:....|.|.||..||::|
Human    11 DRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIV 75

  Fly   106 FPQMNPIARVLEKLDYAVRRICPFLVLGMFLCCIYWIALTYGAFTIIQVVGQDRAMQLME--NKV 168
            ||::.|:..||:..|..:.:.|||...|:.:..|||.|:||||.|::||||....:.:||  :.:
Human    76 FPKLGPVVYVLDLADRLISKACPFAAAGIMVGSIYWTAVTYGAVTVMQVVGHKEGLDVMERADPL 140

  Fly   169 ILLVGLPFIPVGLILFRLVRWKDAVLKAMRSIYIYIPRKLPFFHRTNQSEGASRDLGDLGDLDDL 233
            .||:|||.|||.|||.:::||:|.||:..|.    ...||...:                     
Human   141 FLLIGLPTIPVMLILGKMIRWEDYVLRLWRK----YSNKLQILN--------------------- 180

  Fly   234 SVSSSSSISLP--PIQHNPSITEPFYISRLICGAFFLPTFATTVGNVFFGRLDDALQRTILGGIA 296
            |:.......:|  |.:.|| :.:....:|::|||...||.||.||.:.|..::..||||||||||
Human   181 SIFPGIGCPVPRIPAEANP-LADHVSATRILCGALVFPTIATIVGKLMFSSVNSNLQRTILGGIA 244

  Fly   297 YIGIKGLLKMYLDQKLYLRRLGRCILNYTDE 327
            ::.|||..|:|..|:.|||:..|.||||.::
Human   245 FVAIKGAFKVYFKQQQYLRQAHRKILNYPEQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16781NP_001259211.1 RINGv 43..99 CDD:128983 34/55 (62%)
MARCHF5NP_060294.1 RING_CH-C4HC3_MARCH5 12..72 CDD:319615 36/59 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153120
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6573
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1210654at2759
OrthoFinder 1 1.000 - - FOG0003968
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104806
Panther 1 1.100 - - O PTHR46283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X270
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.660

Return to query results.
Submit another query.