DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16781 and CG2991

DIOPT Version :9

Sequence 1:NP_001259211.1 Gene:CG16781 / 31315 FlyBaseID:FBgn0029661 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_608725.1 Gene:CG2991 / 33488 FlyBaseID:FBgn0031474 Length:562 Species:Drosophila melanogaster


Alignment Length:128 Identity:28/128 - (21%)
Similarity:51/128 - (39%) Gaps:44/128 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SQHSELSNADGE-----RICWICFATSEDNPHAHWVQPCQCRGDTKWVHQSCLYRWIDEKQLGDR 89
            ::.::||..:|:     :.||||:.:.:..|   .:|||:|.||...||..||.||:.|......
  Fly   373 AETNKLSPEEGQSFLTKKDCWICYDSDKPEP---LIQPCRCTGDVSSVHHECLKRWLVESCSNSE 434

  Fly    90 RQ------------------------------------TVICQQCQTEYIMVFPQMNPIARVL 116
            .|                                    |::|....|.::::...::|:.||:
  Fly   435 AQLSCKVCGHPYEIEKSKKLEWDKGFTIQHWSKTVILITLMCVTGATAWVVIQMYVDPLVRVM 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16781NP_001259211.1 RINGv 43..99 CDD:128983 21/91 (23%)
CG2991NP_608725.1 SSM4 389..>494 CDD:227510 23/107 (21%)
RING_CH-C4HC3_MARCH 392..443 CDD:319409 19/53 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1210654at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.