DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16781 and march5l

DIOPT Version :9

Sequence 1:NP_001259211.1 Gene:CG16781 / 31315 FlyBaseID:FBgn0029661 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_956033.2 Gene:march5l / 326067 ZFINID:ZDB-GENE-030131-4792 Length:289 Species:Danio rerio


Alignment Length:311 Identity:127/311 - (40%)
Similarity:179/311 - (57%) Gaps:39/311 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ERICWICFATSEDNPHAHWVQPCQCRGDTKWVHQSCLYRWIDEKQLGDRRQTVICQQCQTEYIMV 105
            |:.||:||||.:::..|.||.||:|:|.|||:|||||.||:||||.|:....|.|.||.|||.:|
Zfish     9 EKHCWVCFATEKEDRAAEWVSPCRCKGCTKWIHQSCLQRWLDEKQKGNSGGAVSCPQCGTEYRIV 73

  Fly   106 FPQMNPIARVLEKLDYAVRRICPFLVLGMFLCCIYWIALTYGAFTIIQVVGQDRAMQLME--NKV 168
            ||:|.|:...|:::|.|:.|..||...|:.:..:||.|:||||.|::||||..:.:.:||  :.:
Zfish    74 FPKMGPVVYFLQQVDRALSRASPFAAAGVVVGTVYWSAVTYGAVTVMQVVGHKKGLDVMERADPL 138

  Fly   169 ILLVGLPFIPVGLILFRLVRWKDAVLKAMRSIYIYIPRKLPFFHRTNQSEGASRDL------GDL 227
            .||:|||.|||.|:|.:::||:|.|::    ::.....||..|  :....|..|.|      |..
Zfish   139 FLLMGLPTIPVMLVLGKMIRWEDYVVR----LWQRHSAKLQIF--SGLVPGMGRALPRVPVEGSY 197

  Fly   228 GDLDDLSVSSSSSISLPPIQHNPSITEPFYISRLICGAFFLPTFATTVGNVFFGRLDDALQRTIL 292
            |. |.|||                       ||.:|||...|:.|..||.:.|.|:...||||||
Zfish   198 GG-DHLSV-----------------------SRTLCGALIFPSIANLVGRLLFRRVTSNLQRTIL 238

  Fly   293 GGIAYIGIKGLLKMYLDQKLYLRRLGRCILNYTDENVRMIDQHTQDNSNYN 343
            ||||::.:||:||:|..|:.||.:..|.|||| .|.....|..|:|..:.|
Zfish   239 GGIAFVVMKGVLKVYFKQQQYLIQANRHILNY-PEPEGQADGATEDEDSSN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16781NP_001259211.1 RINGv 43..99 CDD:128983 31/55 (56%)
march5lNP_956033.2 RINGv 11..67 CDD:128983 31/55 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588156
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1210654at2759
OrthoFinder 1 1.000 - - FOG0003968
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104806
Panther 1 1.100 - - O PTHR46283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X270
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.710

Return to query results.
Submit another query.