DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16781 and Marchf5

DIOPT Version :9

Sequence 1:NP_001259211.1 Gene:CG16781 / 31315 FlyBaseID:FBgn0029661 Length:386 Species:Drosophila melanogaster
Sequence 2:XP_008758589.1 Gene:Marchf5 / 294079 RGDID:1305617 Length:293 Species:Rattus norvegicus


Alignment Length:306 Identity:123/306 - (40%)
Similarity:173/306 - (56%) Gaps:45/306 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ERICWICFATSEDNPHAHWVQPCQCRGDTKWVHQSCLYRWIDEKQLGDRRQTVICQQCQTEYIMV 105
            :|.||:||||.||:..|.||:||:|||.||||||:||.||:||||.|:....|.|.||..||::|
  Rat    11 DRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIV 75

  Fly   106 FPQMNPIARVLEKLDYAVRRICPFLVLGMFLCCIYWIALTYGAFTIIQ---------------VV 155
            ||::.|:..||:..|..:.:.|||...|:.:..|||.|:||||.|::|               ||
  Rat    76 FPKLGPVVYVLDLADRLISKACPFAAAGIMVGSIYWTAVTYGAVTVMQVHHSTLFSDTTFDVKVV 140

  Fly   156 GQDRAMQLME--NKVILLVGLPFIPVGLILFRLVRWKDAVLKAMRSIYIYIPRKLPFFHRTNQSE 218
            |....:.:||  :.:.||:|||.|||.|||.:::||:|.||:..|.    ...||...:      
  Rat   141 GHKEGLDVMERADPLFLLIGLPTIPVMLILGKMIRWEDYVLRLWRK----YSNKLQILN------ 195

  Fly   219 GASRDLGDLGDLDDLSVSSSSSISLP--PIQHNPSITEPFYISRLICGAFFLPTFATTVGNVFFG 281
                           |:.......:|  |.:.|| :.:....:|::|||...||.||.||.:.|.
  Rat   196 ---------------SIFPGIGCPVPRIPAEANP-LADHVSATRILCGALVFPTIATIVGKLMFS 244

  Fly   282 RLDDALQRTILGGIAYIGIKGLLKMYLDQKLYLRRLGRCILNYTDE 327
            .::..||||||||||::.|||..|:|..|:.|||:..|.||||.::
  Rat   245 SVNSNLQRTILGGIAFVAIKGAFKVYFKQQQYLRQAHRKILNYPEQ 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16781NP_001259211.1 RINGv 43..99 CDD:128983 34/55 (62%)
Marchf5XP_008758589.1 RING_CH-C4HC3_MARCH5 12..72 CDD:319615 36/59 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346723
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1210654at2759
OrthoFinder 1 1.000 - - FOG0003968
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104806
Panther 1 1.100 - - O PTHR46283
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.710

Return to query results.
Submit another query.