powered by:
Protein Alignment CG16781 and M110.3
DIOPT Version :9
Sequence 1: | NP_001259211.1 |
Gene: | CG16781 / 31315 |
FlyBaseID: | FBgn0029661 |
Length: | 386 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_495728.1 |
Gene: | M110.3 / 187472 |
WormBaseID: | WBGene00010913 |
Length: | 189 |
Species: | Caenorhabditis elegans |
Alignment Length: | 62 |
Identity: | 27/62 - (43%) |
Similarity: | 33/62 - (53%) |
Gaps: | 4/62 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 ERICWICFATSEDNPHAHWVQPCQCRGDTKWVHQSCLYRWIDEKQLGDRRQTVICQQCQTEY 102
|:.|..||.|..||. ..:|.||:|||...|||..||..|..: .:..|.|:|.||||.|
Worm 13 EKYCKFCFGTESDNA-LSFVHPCRCRGSIHWVHHQCLAMWFSK---ANAVQQVMCIQCQTRY 70
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160162764 |
Domainoid |
1 |
1.000 |
59 |
1.000 |
Domainoid score |
I7056 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3053 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D426217at33208 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003968 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm14746 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X270 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
8 | 7.800 |
|
Return to query results.
Submit another query.