DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16781 and marchf5

DIOPT Version :9

Sequence 1:NP_001259211.1 Gene:CG16781 / 31315 FlyBaseID:FBgn0029661 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001116950.1 Gene:marchf5 / 100144728 XenbaseID:XB-GENE-946356 Length:283 Species:Xenopus tropicalis


Alignment Length:290 Identity:122/290 - (42%)
Similarity:170/290 - (58%) Gaps:30/290 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ERICWICFATSEDNPHAHWVQPCQCRGDTKWVHQSCLYRWIDEKQLGDRRQTVICQQCQTEYIMV 105
            :|.||:||||.||:..|.||:||:|||.||||||:||.||:||||.|:....|.|.||..||::|
 Frog    14 DRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIV 78

  Fly   106 FPQMNPIARVLEKLDYAVRRICPFLVLGMFLCCIYWIALTYGAFTIIQVVGQDRAMQLME--NKV 168
            ||.:.|:..||:..|..:.:.|||...|:.:..|||.|:||||.|::||||....:.:||  :.:
 Frog    79 FPNLGPVVYVLDLADRLISKACPFAAAGIMVGSIYWTAVTYGAVTVMQVVGHKEGLDVMERADPL 143

  Fly   169 ILLVGLPFIPVGLILFRLVRWKDAVLKAMRSIYIYIPRKLPFFHRTNQSEGASRDLGDLGDLDDL 233
            .||:|||.|||.|||.:::||:|.||:..|.    ...||...:                     
 Frog   144 FLLIGLPTIPVVLILGKMIRWEDYVLRLWRK----YSNKLQILN--------------------- 183

  Fly   234 SVSSSSSISLP--PIQHNPSITEPFYISRLICGAFFLPTFATTVGNVFFGRLDDALQRTILGGIA 296
            |:.......:|  |.:.|| :.:....:|::|||...||.||.||.:.|..::..||||||||||
 Frog   184 SIFPGIGCPVPRVPAEANP-LADHVSATRILCGALVFPTIATIVGKLMFSTVNSNLQRTILGGIA 247

  Fly   297 YIGIKGLLKMYLDQKLYLRRLGRCILNYTD 326
            ::.|||..|:|..|:.|||:..|.||:..|
 Frog   248 FVAIKGAFKVYFKQQQYLRQAHRKILDSQD 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16781NP_001259211.1 RINGv 43..99 CDD:128983 34/55 (62%)
marchf5NP_001116950.1 RING_CH-C4HC3_MARCH5 15..75 CDD:319615 36/59 (61%)
RING-CH finger (C4HC3-type) 17..71 CDD:319615 33/53 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1210654at2759
OrthoFinder 1 1.000 - - FOG0003968
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.