DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10801 and Klhl5

DIOPT Version :10

Sequence 1:NP_570058.1 Gene:CG10801 / 31314 FlyBaseID:FBgn0029660 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_780383.2 Gene:Klhl5 / 71778 MGIID:1919028 Length:708 Species:Mus musculus


Alignment Length:122 Identity:25/122 - (20%)
Similarity:56/122 - (45%) Gaps:17/122 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 CPEIMIVMQSRLRKCFLPIVASWEFLEFDVNEVTTLLEQDMLCVNSEDEIFFAVFHWLNYSWTER 382
            |.::..|..:...:.|:.::.:.||:....||:..||..|.:.:.:|:.|..|:..|:.:...:|
Mouse   287 CTDLHKVAHNYTMEHFMEVIRNQEFVLLPANEIAKLLASDDMNIPNEETILNALLTWVRHDLEQR 351

  Fly   383 KKHAVKVMQKVRFGLLSPWLRRSICNMPENDRIGEIGQLPEICSLIWEGTLLCQAII 439
            :|...:::..:|..||:|   :.:.:|..|              .::...:.||.:|
Mouse   352 RKDLSRLLAYIRLPLLAP---QFLADMENN--------------ALFRDDIECQKLI 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10801NP_570058.1 BACK 306..401 CDD:462237 19/82 (23%)
DUF4734 417..512 CDD:434992 3/23 (13%)
Klhl5NP_780383.2 PHA03098 173..695 CDD:222983 25/122 (20%)
KELCH repeat 457..500 CDD:276965
KELCH repeat 504..548 CDD:276965
KELCH repeat 551..594 CDD:276965
KELCH repeat 598..648 CDD:276965
KELCH repeat 651..694 CDD:276965
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.