DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10801 and CG12857

DIOPT Version :9

Sequence 1:NP_570058.1 Gene:CG10801 / 31314 FlyBaseID:FBgn0029660 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_610987.1 Gene:CG12857 / 36642 FlyBaseID:FBgn0033963 Length:440 Species:Drosophila melanogaster


Alignment Length:383 Identity:96/383 - (25%)
Similarity:171/383 - (44%) Gaps:74/383 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 KLDESCAENILSRCTRRMNNNEIMWKATKMCWFDDLEIQIESRFFFVSHILFTYFARNFRKIS-- 234
            ||::.|.:. |:...|.|..:.:  |.|       ::|:|.:.:|....|:...::|.|.::.  
  Fly    91 KLEQPCKDR-LATVLRYMFESHL--KTT-------VQIEINNMYFNCHFIVLQVYSRFFSELEMI 145

  Fly   235 SQFLQMPVQKIDMAVLIRIYEWMLNEEKTFVVGQNLISFYAAAHWLGVHQLIKQAWSTFSADGVY 299
            ...:.:|.:.:.....:..|:|||::|....:. :::..|.||.:|.:..|....|..|..:..|
  Fly   146 PLLVTLPEKIVSQKAFMLSYKWMLSDEPVLELA-HIVEVYVAATYLRISGLAAHCWKYFDDEEYY 209

  Fly   300 DIWEINAFQAYIMAKDYRCPEIM-IVMQSRLRKCFLPIVASWEFLEFDVNEVTTLLEQDMLCVNS 363
            :  |..|...|:.:||....::: .:|.:|:||..|..||:.:||:...:.:..|||.|.:|||:
  Fly   210 N--EDTACVLYVESKDNPAMDVVRNLMLTRIRKFLLTFVATRDFLDLPTSHLIFLLESDQICVNT 272

  Fly   364 EDEIFFAVFHWLNYSWTERKKHAVKVMQKVRFGLLSPW----LRRSICNMPENDRIGEIGQLPEI 424
            |.|:||....||.:.|.:||.|..::|..:||.|:..|    .||      |.|.       |.:
  Fly   273 EIEVFFIAVRWLGHDWNKRKVHVRRLMSCIRFNLMPLWYLLYARR------EEDH-------PLV 324

  Fly   425 CSLIWEGTLLCQAIIAIGQPEYR----RSRLVRRMLRDF---------EHKRIT-ERSWVFCEGV 475
            ..||:.           .:.||:    .||:..||..|.         |:...: :|:|: |:.:
  Fly   325 MKLIFN-----------PEVEYKIDESISRITSRMYEDALEGNDAQSEEYASDSGQRNWI-CDSL 377

  Fly   476 -PHHHDKKCARYRELTFESFKRFLHRL------HTNSDIFMESLKAVPNKITNTYRCC 526
             .::|...|...||:.|:.|:.:|..|      |.:..||.:..|.:.        ||
  Fly   378 CSYYHGVGCPNTREIRFKHFEDYLSELQQCSKDHWSQVIFQDPSKKID--------CC 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10801NP_570058.1 BACK 306..401 CDD:285009 34/95 (36%)
DUF4734 418..512 CDD:292506 25/114 (22%)
CG12857NP_610987.1 BTB 104..199 CDD:295341 21/104 (20%)
BACK 215..313 CDD:197943 34/97 (35%)
DUF4734 327..415 CDD:292506 22/99 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469515
Domainoid 1 1.000 65 1.000 Domainoid score I17071
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22667
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.