DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10801 and CG12692

DIOPT Version :9

Sequence 1:NP_570058.1 Gene:CG10801 / 31314 FlyBaseID:FBgn0029660 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_001284857.1 Gene:CG12692 / 31372 FlyBaseID:FBgn0029703 Length:553 Species:Drosophila melanogaster


Alignment Length:392 Identity:91/392 - (23%)
Similarity:144/392 - (36%) Gaps:78/392 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 PMSSKLDESCAENILSRCTRRMNNNEIMWKA----TKMC------WFDDLEIQIESRFFFVSHIL 222
            |.|:::.....|.| ..|...|:.:..::::    |::|      |.....:|..|         
  Fly    29 PWSNEIHRRHGEAI-HPCNDAMDFHASVFRSLGAVTRVCIGTSTFWCTSSLLQFHS--------- 83

  Fly   223 FTYFARNFRKISSQFLQMPV----QKIDM-AVLIR-IYEWMLNEE--KTFVVGQNLISFYAAAHW 279
             .||.||.         .||    :..|: ||..| .|.||..:|  ..|:....|::....|..
  Fly    84 -NYFDRNI---------CPVNCFREGTDLIAVGFRAAYTWMRLQEPLDPFMQPDKLMTLLHTAVQ 138

  Fly   280 LGVHQLIKQAWSTFSADGVYDIWEINAFQAYIMAKDY-RCPEIMIVMQSRLRKCFLPIVASWEFL 343
            |.:..|....:.....|   ...|..|||.|:.|..| :..|:..:|..|:...||.::...:|.
  Fly   139 LEMPALKALCYEQLCTD---RFREETAFQVYLRALKYPQLEELRKLMLQRIGAAFLAVLGGDDFQ 200

  Fly   344 EFDVNEVTTLLEQDMLCVNSEDEIFFAVFHWLNYSWTERKKHAVKVMQKVRFGLLSPWLRRSICN 408
            ...:.:|.|:|:||.|.||||.|:..|:..|||..        .|.:.:.. .||...||.::..
  Fly   201 RMPLEDVITMLQQDSLGVNSEMEVLVAIIRWLNCQ--------SKCIDQAT-PLLMDCLRLTLLP 256

  Fly   409 MPENDRIGEIGQLPEICSLIW----EGTLLCQAII--AIGQPEYRRSRLVRRMLRDFEHKR---- 463
            :|...|.......|.:....:    .|.:..:..|  ||...:.......||...||...:    
  Fly   257 LPILKRFWRCAMAPPVPDEPFMNAVRGNIHIRERISCAITVVQMHHLHTSRREFLDFCRSKGLLV 321

  Fly   464 ITERSWVFCEGVPHHHDKKCARYRELTFESFKRFLHRLHTNSDI-------FMESLKAVPNKITN 521
            ...|.|::.|...:|..:....|..|..         :|..|:.       .|||.|..|.:: |
  Fly   322 DMPREWIYDEQCHYHLPRPGGPYSHLIC---------VHVISNYAIQRAQRLMESSKRWPRRV-N 376

  Fly   522 TY 523
            ||
  Fly   377 TY 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10801NP_570058.1 BACK 306..401 CDD:285009 30/95 (32%)
DUF4734 418..512 CDD:292506 19/110 (17%)
CG12692NP_001284857.1 BACK 162..265 CDD:285009 34/111 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469510
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22667
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.