DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10801 and CG14785

DIOPT Version :9

Sequence 1:NP_570058.1 Gene:CG10801 / 31314 FlyBaseID:FBgn0029660 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_569912.2 Gene:CG14785 / 31094 FlyBaseID:FBgn0027795 Length:470 Species:Drosophila melanogaster


Alignment Length:332 Identity:87/332 - (26%)
Similarity:147/332 - (44%) Gaps:52/332 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 KISSQFLQMPVQKIDMAVLIRIYEWMLNEEKTFVVG--QNLISFYAAAHW--------------- 279
            ::|.|.|.:..::..|...|    ::.||...|..|  ||....|||..:               
  Fly   148 RVSEQLLHVLREQTLMEAGI----FVGNERYRFFKGVLQNYAKIYAARKFIDKLPKLDQLGPDAG 208

  Fly   280 --------------LGVHQLIKQAWSTFSADGVYDIWEINAFQAYIMAKDYRCPEIMI---VMQS 327
                          |.:.||::|..|:.|....::  |..||:||:..:.:  |:..|   :|.:
  Fly   209 AERELFARVVAEEVLQIPQLLRQLRSSLSKMEFFN--EDTAFKAYLEVRYH--PQARILCELMLT 269

  Fly   328 RLRKCFLPIVASWEFLEFDVNEVTTLLEQDMLCVNSEDEIFFAVFHWLNYSWTERKKHAVKVMQK 392
            |:.:.||.||.|..||.|..:|:|.:|....|.||||.|||.:|..||.::|.||...|.:::.:
  Fly   270 RISRVFLCIVGSPFFLYFTEHELTHILRNCYLSVNSEIEIFLSVVLWLEHNWLERGDCAERILAE 334

  Fly   393 VRFGLLSPWLRRSICNMPENDRIGEIGQL---PEICSLIWEGTLLCQAIIAIGQPEYRRSRLVRR 454
            |.|.|:..|.   :|.:..::|.....::   |.:..||..|  |..||....:|.:..:.|.|:
  Fly   335 VHFALMPTWY---LCTLDRSNRCNHFARVIHSPGVQRLIAAG--LEDAITLKSKPRFSGAALHRQ 394

  Fly   455 MLRDFEHKRITERSWVFCEGVPHHHDKKCARYRELTFESFKRFLHRLHTNSDIFMESLKAVPNKI 519
              |..:.:|:..|.|:......|||...|.::...|:::||.:|.|:...:.....:.:......
  Fly   395 --RKHQEERLLVRDWIVDTECSHHHKSHCEQFVYPTYDAFKEYLARIICCAPNCWRTFRPAQEVY 457

  Fly   520 TNTYRCC 526
            ...:|||
  Fly   458 RRDFRCC 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10801NP_570058.1 BACK 306..401 CDD:285009 37/97 (38%)
DUF4734 418..512 CDD:292506 23/96 (24%)
CG14785NP_569912.2 BACK 256..345 CDD:197943 34/93 (37%)
DUF4734 360..450 CDD:292506 23/93 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469505
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22667
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.