DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10801 and Klhl41

DIOPT Version :10

Sequence 1:NP_570058.1 Gene:CG10801 / 31314 FlyBaseID:FBgn0029660 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_001074556.1 Gene:Klhl41 / 228003 MGIID:2683854 Length:606 Species:Mus musculus


Alignment Length:82 Identity:21/82 - (25%)
Similarity:40/82 - (48%) Gaps:0/82 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 CPEIMIVMQSRLRKCFLPIVASWEFLEFDVNEVTTLLEQDMLCVNSEDEIFFAVFHWLNYSWTER 382
            ||.:.|..:..:...|:.|....:|::....|:.:::..|.|.|..|:.:|.||..|:......|
Mouse   147 CPRLAISAREFVSDRFVQICKEEDFMQLSPQELISVISNDSLNVEKEEVVFEAVMKWVRTDKENR 211

  Fly   383 KKHAVKVMQKVRFGLLS 399
            .|:..:|...:||.|::
Mouse   212 AKNLSEVFDCIRFRLMA 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10801NP_570058.1 BACK 306..401 CDD:462237 21/82 (26%)
DUF4734 417..512 CDD:434992
Klhl41NP_001074556.1 BTB_POZ_KLHL41_KBTBD10 6..135 CDD:349650
PHA03098 39..578 CDD:222983 21/82 (26%)
KELCH repeat 335..384 CDD:276965
Kelch 1 346..398
KELCH repeat 388..433 CDD:276965
Kelch 2 399..447
KELCH repeat 437..482 CDD:276965
Kelch 3 448..495
KELCH repeat 485..530 CDD:276965
Kelch 4 497..542
Kelch 5 544..599
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.