DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10801 and kel-3

DIOPT Version :9

Sequence 1:NP_570058.1 Gene:CG10801 / 31314 FlyBaseID:FBgn0029660 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_499784.2 Gene:kel-3 / 176775 WormBaseID:WBGene00002185 Length:591 Species:Caenorhabditis elegans


Alignment Length:288 Identity:69/288 - (23%)
Similarity:116/288 - (40%) Gaps:57/288 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 NEIMWKATKMCWFDDLEIQIESRFFFVSHILFT----YF---------ARNFRKISSQFLQMPVQ 243
            ||:..|    |...|:.:.:|:|......::..    ||         ..|.::|:.:...|..:
 Worm    42 NELRSK----CQLCDVALLVENRKLSAHKVILAATIPYFRGMFTLDLMEANMKEINIEDSDMNYE 102

  Fly   244 KIDMAVLIRIYEWML----NEEKTFVVGQNLISFYAAAHWLGVHQLIKQAWSTFSADGVYDIWEI 304
            .:| |:|...|...|    :..::.::|.|...........|...|.:...|  :|..:.:..::
 Worm   103 TVD-ALLSFAYTGELRITTSNVQSIMLGANFFQMLEVVQHCGNFLLTRLHPS--NALSIREFCKM 164

  Fly   305 NAFQAYI--MAKDYRCPEIMIVMQSRLRKCFLPIVASWEFLEFDVNEVTTLLEQDMLCVNSEDEI 367
            ...:..|  |..||            ::|.|:.:....:|....:.:...||..|.|.|:||:::
 Worm   165 MCVEEKITEMTDDY------------IQKHFMAVSKDEDFKRLSLEDAIELLRNDHLYVDSEEQV 217

  Fly   368 FFAVFHWLNYSWTERKKHAVKVMQKVRFGLLSPWLRRSIC--------NMPENDRIGEIGQ---L 421
            :.|...|||.. ..|.:.|.|::..||..||||....||.        ::|..|.|.|...   |
 Worm   218 YVAAMEWLNCD-VIRHEQAAKILPCVRLPLLSPTYLSSIVASNPIIKKDIPCRDLIDEAKDYHLL 281

  Fly   422 PEICSLI--WEGT-LLCQ----AIIAIG 442
            |:..|||  ::.| .|||    .|:|||
 Worm   282 PDRRSLIKSFKCTPRLCQIVPGLIVAIG 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10801NP_570058.1 BACK 306..401 CDD:285009 26/96 (27%)
DUF4734 418..512 CDD:292506 13/35 (37%)
kel-3NP_499784.2 BTB_POZ 32..149 CDD:365784 21/111 (19%)
PHA03098 51..568 CDD:222983 65/275 (24%)
KELCH repeat 341..384 CDD:276965
KELCH repeat 388..431 CDD:276965
KELCH repeat 435..479 CDD:276965
KELCH repeat 482..527 CDD:276965
KELCH repeat 529..572 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.