DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10801 and KLHL40

DIOPT Version :10

Sequence 1:NP_570058.1 Gene:CG10801 / 31314 FlyBaseID:FBgn0029660 Length:558 Species:Drosophila melanogaster
Sequence 2:NP_689606.2 Gene:KLHL40 / 131377 HGNCID:30372 Length:621 Species:Homo sapiens


Alignment Length:261 Identity:46/261 - (17%)
Similarity:90/261 - (34%) Gaps:71/261 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 YFARNFRKISSQFLQMPVQKIDMAVLIRIYEWMLNEEKTFVVGQNLISFYAAAH----------- 278
            ||...|.....:..::.::::...|:.::..::...| ..:...::...:||||           
Human    57 YFRARFLAEPERAGELHLEEVSPDVVAQVLHYLYTSE-IALDEASVQDLFAAAHRFQIPSIFTIC 120

  Fly   279 --WLGVHQLIKQAWSTFSADGVYDIWEINAFQAYIMAKDYRCPEIMIVMQSRLRKCFLPIVASWE 341
              :|.....:....:.|....:.|     ..:..:.|:|:.|....:|.:..            :
Human   121 VSFLQKRLCLSNCLAVFRLGLLLD-----CARLAVAARDFICAHFTLVARDA------------D 168

  Fly   342 FLEFDVNEVTTLLEQDMLCVNSEDEIFFAVFHWLN----YSWTERKKHAVKVMQKVRFGLL-SPW 401
            ||....:|:..::..|.|.|..|:.:|.||..|..    .:..||::....|.:.||..|| ..:
Human   169 FLGLSADELIAIISSDGLNVEKEEAVFEAVMRWAGSGDAEAQAERQRALPTVFESVRCRLLPRAF 233

  Fly   402 LRRSICNMPENDRIGEIGQLPEICSLIWEGTLLCQAIIAIGQPEYRRSRLVRR--MLRDFEHKRI 464
            |...:...|                            :...|||     |:|:  |::|....||
Human   234 LESRVERHP----------------------------LVRAQPE-----LLRKVQMVKDAHEGRI 265

  Fly   465 T 465
            |
Human   266 T 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10801NP_570058.1 BACK 306..401 CDD:462237 22/99 (22%)
DUF4734 417..512 CDD:434992 10/51 (20%)
KLHL40NP_689606.2 BTB_POZ_KLHL40_KBTBD5 6..137 CDD:349649 10/80 (13%)
PHA03098 47..551 CDD:222983 46/261 (18%)
BACK 128..230 CDD:475122 23/118 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..295 2/2 (100%)
KELCH repeat 351..398 CDD:276965
Kelch 1 360..412
KELCH repeat 402..448 CDD:276965
Kelch 2 413..462
KELCH repeat 452..497 CDD:276965
Kelch 3 463..510
Kelch 4 512..557
Kelch_1 547..594 CDD:396078
KELCH repeat 547..594 CDD:276965
Kelch 5 559..613
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.