DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16782 and CG14537

DIOPT Version :9

Sequence 1:NP_570057.1 Gene:CG16782 / 31313 FlyBaseID:FBgn0029659 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_609155.1 Gene:CG14537 / 34072 FlyBaseID:FBgn0031954 Length:203 Species:Drosophila melanogaster


Alignment Length:193 Identity:61/193 - (31%)
Similarity:99/193 - (51%) Gaps:13/193 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLNVVLCGAAGFGFYKIGPSEHPYAFTACVFGFCHGLFGL-----ASGLTGDDNAKKIAETTTSI 69
            |.|.:|..:|.....|:.|.|||:|..|||......:|||     |||  ..:..:::.:.|:.:
  Fly    13 VYNGLLLASAVCTGRKMLPEEHPFAMVACVVVGFSAVFGLLRVIFASG--QPEECQQLRDITSGV 75

  Fly    70 MEIIPLPLVNVELYLAAES-NNIALGHGLFIVPLAVSVILTFFKGESGDESEGGPLDTLKTLTIL 133
            :|:.||||.|::.|:.:.. :.|||||..|::||...:..:..|    |..:....|:|:.||:|
  Fly    76 LELAPLPLANMDFYMQSTGLSPIALGHAFFVLPLFCDLGCSLAK----DRRDCAFSDSLRNLTVL 136

  Fly   134 GNITSLAYLAINESSWNLGGMAILAFMAKFGAKFFEEQISEGSGEPVNYLSWSGFYFLTAMAV 196
            |||.||.:||..|.::....|.::..:.|:|. ...:.|.|.:||.:.....:.|..|...||
  Fly   137 GNIVSLGFLAYVERNFLYLRMVLVMIVVKYGV-VLVDSIKEDAGEDLQVCGTALFMHLLGKAV 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16782NP_570057.1 DUF4791 28..195 CDD:292658 54/172 (31%)
CG14537NP_609155.1 DUF4791 31..197 CDD:292658 54/172 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448650
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FABI
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014287
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.