DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16782 and CG14269

DIOPT Version :10

Sequence 1:NP_570057.1 Gene:CG16782 / 31313 FlyBaseID:FBgn0029659 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_570056.1 Gene:CG14269 / 31312 FlyBaseID:FBgn0029658 Length:190 Species:Drosophila melanogaster


Alignment Length:194 Identity:63/194 - (32%)
Similarity:105/194 - (54%) Gaps:8/194 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VSCVLNVVLCGAAGFGFYKIGPSEHPYAFTACVFGFCHGLFGLASGLTGDDN-AKKIAETTTSIM 70
            :..:.|.:|..::|:..|.:.|.|.||.:........||:.|:....:.||: ..::...|:.||
  Fly     4 MDALFNSLLVVSSGYAIYTLHPMETPYGYATAALSLVHGILGMVRAASNDDDECNRVRLITSGIM 68

  Fly    71 EIIPLPLVNVELYLAAESNNIALGHGLFIVPLAVSVILTFFKGESGDESEGGPLDTLKTLTILGN 135
            ||:||||.|:||||.:.:..:||.|..|:|||...::....      ::|....:|||.||:|||
  Fly    69 EIVPLPLTNMELYLKSTNPGLALAHTCFVVPLVYDMLAKVV------DTEDTVTETLKELTLLGN 127

  Fly   136 ITSLAYLAINESSWNLGGMAILAFMAKFGAKFFEEQISEGSGEPVNYLSWSGFYFLTAMAVSGE 199
            :.|:.:|.:|||:...|.:|.:||.|::|:.|. :...:|.|.....|:.|.|..|..|.:|.:
  Fly   128 VVSMLFLGVNESNNMYGILAAIAFGARYGSAFL-DYYWKGLGAEFTLLAHSMFVLLMTMTLSAK 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16782NP_570057.1 DUF4791 28..195 CDD:406447 57/167 (34%)
CG14269NP_570056.1 DUF4791 25..186 CDD:406447 57/167 (34%)

Return to query results.
Submit another query.