DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14269 and CG14537

DIOPT Version :9

Sequence 1:NP_001259207.1 Gene:CG14269 / 31312 FlyBaseID:FBgn0029658 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_609155.1 Gene:CG14537 / 34072 FlyBaseID:FBgn0031954 Length:203 Species:Drosophila melanogaster


Alignment Length:185 Identity:61/185 - (32%)
Similarity:103/185 - (55%) Gaps:11/185 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFNSLLVVSSGYAIYTLHPMETPYGYATAALSLVHGILGMVRA--ASNDDDECNRVRLITSGIME 69
            ::|.||:.|:......:.|.|.|:......:.....:.|::|.  ||...:||.::|.||||::|
  Fly    13 VYNGLLLASAVCTGRKMLPEEHPFAMVACVVVGFSAVFGLLRVIFASGQPEECQQLRDITSGVLE 77

  Fly    70 IVPLPLTNMELYLKST--NPGLALAHTCFVVPLVYDM---LAKVVDTED-TVTETLKELTLLGNV 128
            :.||||.||:.|::||  :| :||.|..||:||..|:   |||  |..| ..:::|:.||:|||:
  Fly    78 LAPLPLANMDFYMQSTGLSP-IALGHAFFVLPLFCDLGCSLAK--DRRDCAFSDSLRNLTVLGNI 139

  Fly   129 VSMLFLGVNESNNMYGILAAIAFGARYGSAFLDYYWKGLGAEFTLLAHSMFVLLM 183
            ||:.||...|.|.:|..:..:....:||...:|...:..|.:..:...::|:.|:
  Fly   140 VSLGFLAYVERNFLYLRMVLVMIVVKYGVVLVDSIKEDAGEDLQVCGTALFMHLL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14269NP_001259207.1 DUF4791 25..186 CDD:292658 57/167 (34%)
CG14537NP_609155.1 DUF4791 31..197 CDD:292658 57/167 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448651
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FABI
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014287
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.