DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myc and myclb

DIOPT Version :9

Sequence 1:NP_001259204.1 Gene:Myc / 31310 FlyBaseID:FBgn0262656 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001038607.1 Gene:myclb / 567762 ZFINID:ZDB-GENE-030131-5561 Length:404 Species:Danio rerio


Alignment Length:325 Identity:74/325 - (22%)
Similarity:112/325 - (34%) Gaps:99/325 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 CNDMVDDGPNLETPSDSDEEIDVVSYTDKKLPTNPSCHLMGALQFQMAHKISIDHMKQKPRYNNF 457
            |...|..|....|.|..|||||||                           :::|.:.|.|..|.
Zfish   174 CKKQVSSGSESRTDSSDDEEIDVV---------------------------TVEHKQNKSRLVNA 211

  Fly   458 NLPYTPASSSPVKSVANSRYPSPSSTPYQNCSSASP-SY----SPLSVDSSNVSSSSSSSSSQSS 517
            ..|.|....:........|:.........|.::.|| ||    .|.......:.....:|:.|:.
Zfish   212 RKPVTITVRADPHDPCMKRFHISIHQQQHNYAARSPDSYPEEEPPRKKIRQEIVQPRLASTPQTP 276

  Fly   518 FTTSSSNKGRKRSSLKDPGLLISSSSVYLPGVNNKVTHSSMMSKKSRGKKVVGTSSGNTSPISSG 582
                     .::|.|..|.:...|     |.|:...||:|...|           |..:||.|| 
Zfish   277 ---------ERKSPLPSPSVPAQS-----PTVSASPTHTSYHLK-----------SQPSSPQSS- 315

  Fly   583 QDVDAMDRNWQRRSGGIATSTSSNSSVHRKDFVLGFDEADTIEKRNQHNDMERQRRIGLKNLFEA 647
                                                |..|| :||..||.:||:||..|::.|.|
Zfish   316 ------------------------------------DCEDT-DKRKTHNFLERKRRNDLRSRFLA 343

  Fly   648 LKKQIPTIRDKERAPKVNILREAAKLCIQLTQEEKELSMQRQLLSLQLKQRQDTLASYQMELNES 712
            |:.:||.:.|..:.|||.||.:|.:....|...:::.:.:::    |||.:|..|.....||..:
Zfish   344 LRDEIPGLVDCPKTPKVVILTKATEYLRTLHVSDRQKAQEKK----QLKSKQQQLLRRLAELKRA 404

  Fly   713  712
            Zfish   405  404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MycNP_001259204.1 HLH 625..682 CDD:238036 22/56 (39%)
myclbNP_001038607.1 Myc_N 18..283 CDD:279405 28/144 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..195 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..331 30/155 (19%)
HLH 319..374 CDD:238036 23/55 (42%)
Leucine-zipper 373..401 6/31 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45851
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.