DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myc and MYCL

DIOPT Version :9

Sequence 1:NP_001259204.1 Gene:Myc / 31310 FlyBaseID:FBgn0262656 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001028254.2 Gene:MYCL / 4610 HGNCID:7555 Length:394 Species:Homo sapiens


Alignment Length:284 Identity:66/284 - (23%)
Similarity:104/284 - (36%) Gaps:79/284 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   460 PYTPASSSPVKSVANSRYPSPSSTPYQNCSSASPSY-SPLSVDSSNVSSSSSSSSSQSSFTTSSS 523
            |..|..:.|..|.|      |..||.....:.:|:. .||....:...|.|.|.|       .|.
Human   145 PGAPRGNPPKASAA------PDCTPSLEAGNPAPAAPCPLGEPKTQACSGSESPS-------DSE 196

  Fly   524 NKG------RKRSSLKDPGLLISSSSVYLPGVNNKVT---------------HSSMMSKKSRGKK 567
            |:.      .||.||               |:...||               |.|:..::.    
Human   197 NEEIDVVTVEKRQSL---------------GIRKPVTITVRADPLDPCMKHFHISIHQQQH---- 242

  Fly   568 VVGTSSGNTSPISSGQDVDAMDRNWQ-----RRSGG-------------IATSTSSNSSVHRKDF 614
               ..:....|.|..|: :|.:|..|     |.:.|             ....:.:..|.|.|..
Human   243 ---NYAARFPPESCSQE-EASERGPQEEVLERDAAGEKEDEEDEEIVSPPPVESEAAQSCHPKPV 303

  Fly   615 VLGFDEADTIEKRNQHNDMERQRRIGLKNLFEALKKQIPTIRDKERAPKVNILREAAKLCIQLTQ 679
               ..:.:.:.||..||.:||:||..|::.|.||:.|:||:....:||||.||.:|.:....|..
Human   304 ---SSDTEDVTKRKNHNFLERKRRNDLRSRFLALRDQVPTLASCSKAPKVVILSKALEYLQALVG 365

  Fly   680 EEKELSMQRQLLSLQLKQRQDTLA 703
            .||.::.:::.|..:.:|.|..:|
Human   366 AEKRMATEKRQLRCRQQQLQKRIA 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MycNP_001259204.1 HLH 625..682 CDD:238036 23/56 (41%)
MYCLNP_001028254.2 Myc_N 26..258 CDD:279405 29/148 (20%)
HLH 309..363 CDD:238036 22/53 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11673
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45851
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.