DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myc and MYC

DIOPT Version :9

Sequence 1:NP_001259204.1 Gene:Myc / 31310 FlyBaseID:FBgn0262656 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_002458.2 Gene:MYC / 4609 HGNCID:7553 Length:454 Species:Homo sapiens


Alignment Length:260 Identity:81/260 - (31%)
Similarity:114/260 - (43%) Gaps:38/260 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   460 PYTPASSSPVKSVA--NSRYPSPSSTPYQNCSSASPSYSPLSV---DSSNVSSSSSSSSSQSSFT 519
            ||....||..||.|  :|...||||....:.:.:||..||..:   :.:..::||.|...|....
Human   211 PYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEE 275

  Fly   520 TSSSNKGRKRSSLKDPGLLISSSSVYLPGVNNKVTHSSMMSKKSRGKKVVGTSSGN-TSPISSGQ 583
            ........||.:   ||....|.|....| ::|..||.::.|:..    |.|...| .:|.|:.:
Human   276 EIDVVSVEKRQA---PGKRSESGSPSAGG-HSKPPHSPLVLKRCH----VSTHQHNYAAPPSTRK 332

  Fly   584 DVDAMDR------NWQRRSGGIATSTSSNSSVHRKDFVLGFDEADTIE--KRNQHNDMERQRRIG 640
            |..|..|      ...|:.......||..||             ||.|  ||..||.:|||||..
Human   333 DYPAAKRVKLDSVRVLRQISNNRKCTSPRSS-------------DTEENVKRRTHNVLERQRRNE 384

  Fly   641 LKNLFEALKKQIPTIRDKERAPKVNILREAAKLCIQLTQEEKELSMQRQLLSL---QLKQRQDTL 702
            ||..|.||:.|||.:.:.|:||||.||::|....:.:..||::|..:..||..   |||.:.:.|
Human   385 LKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQL 449

  Fly   703  702
            Human   450  449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MycNP_001259204.1 HLH 625..682 CDD:238036 27/58 (47%)
MYCNP_002458.2 Myc_N 21..360 CDD:279405 41/156 (26%)
HLH 370..426 CDD:238036 26/55 (47%)
Myc-LZ 423..453 CDD:280500 9/27 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11673
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 1.056642 Normalized mean entropy S7029
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto90556
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45851
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4673
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.