DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myc and MAX

DIOPT Version :10

Sequence 1:NP_525062.2 Gene:Myc / 31310 FlyBaseID:FBgn0262656 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_002373.3 Gene:MAX / 4149 HGNCID:6913 Length:160 Species:Homo sapiens


Alignment Length:94 Identity:28/94 - (29%)
Similarity:51/94 - (54%) Gaps:10/94 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   625 EKRNQHNDMERQRRIGLKNLFEALKKQIPTIRDKERAPKVNILREAAKLCIQL--------TQEE 681
            :||..||.:||:||..:|:.|.:|:..:|:::. |:|.:..||.:|.:. ||.        .|:.
Human    23 DKRAHHNALERKRRDHIKDSFHSLRDSVPSLQG-EKASRAQILDKATEY-IQYMRRKNHTHQQDI 85

  Fly   682 KELSMQRQLLSLQLKQRQDTLASYQMELN 710
            .:|..|..||..|::..:...:|.|::.|
Human    86 DDLKRQNALLEQQVRALEKARSSAQLQTN 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MycNP_525062.2 bHLHzip_Myc 626..702 CDD:381406 25/83 (30%)
MAXNP_002373.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 8/16 (50%)
bHLHzip_Max 24..92 CDD:381412 21/69 (30%)
Leucine-zipper 81..102 6/20 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..160 3/12 (25%)
Nuclear localization signal 152..156
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.