DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myc and Mxd4

DIOPT Version :9

Sequence 1:NP_001259204.1 Gene:Myc / 31310 FlyBaseID:FBgn0262656 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001381661.1 Gene:Mxd4 / 360961 RGDID:1305093 Length:261 Species:Rattus norvegicus


Alignment Length:111 Identity:33/111 - (29%)
Similarity:56/111 - (50%) Gaps:18/111 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   615 VLGFD---------EADTIEK----RNQHNDMERQRRIGLKNLFEALKKQIPTIRDKERAPKVNI 666
            ||.||         .|..:.|    |:.||::|:.||..|:...|.||:.:|...|..|...:::
  Rat    82 VLPFDGDFARKKTKTAGLVRKAPNNRSSHNELEKHRRAKLRLYLEQLKQLVPLGPDSTRHTTLSL 146

  Fly   667 LREAAKLCIQLTQEE--KELSMQRQLLSLQ--LKQRQDTLASYQME 708
            |:. ||:.|:..:|:  :.||::.||....  ||:|.:.|:...:|
  Rat   147 LKR-AKMHIKKLEEQDRRALSIKEQLQREHRFLKRRLEQLSVQSVE 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MycNP_001259204.1 HLH 625..682 CDD:238036 19/62 (31%)
Mxd4NP_001381661.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.