DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myc and Bmyc

DIOPT Version :9

Sequence 1:NP_001259204.1 Gene:Myc / 31310 FlyBaseID:FBgn0262656 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001013181.2 Gene:Bmyc / 311807 RGDID:1584970 Length:168 Species:Rattus norvegicus


Alignment Length:75 Identity:21/75 - (28%)
Similarity:36/75 - (48%) Gaps:14/75 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YSIMDDQLFSNISIFDMDNDLYDMDKLLSSSTIQSDLEKIEDMESVFQDYDLEEDMKPEIRNI-- 71
            ||...:.:.::.|..|.|.|        |.||  :||.::.. ::|.|.:..:.|.:..::||  
  Rat    66 YSPPCEAVAASFSPRDHDGD--------SFST--ADLPELPG-DAVKQSFVCDPDDETFVKNIIL 119

  Fly    72 -DCMWPAMSS 80
             ||||...|:
  Rat   120 QDCMWNGFSA 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MycNP_001259204.1 HLH 625..682 CDD:238036
BmycNP_001013181.2 Myc_N 6..>159 CDD:395839 21/75 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..94 11/37 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45851
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.