powered by:
Protein Alignment Myc and Bmyc
DIOPT Version :9
Sequence 1: | NP_001259204.1 |
Gene: | Myc / 31310 |
FlyBaseID: | FBgn0262656 |
Length: | 717 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001013181.2 |
Gene: | Bmyc / 311807 |
RGDID: | 1584970 |
Length: | 168 |
Species: | Rattus norvegicus |
Alignment Length: | 75 |
Identity: | 21/75 - (28%) |
Similarity: | 36/75 - (48%) |
Gaps: | 14/75 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 YSIMDDQLFSNISIFDMDNDLYDMDKLLSSSTIQSDLEKIEDMESVFQDYDLEEDMKPEIRNI-- 71
||...:.:.::.|..|.|.| |.|| :||.::.. ::|.|.:..:.|.:..::||
Rat 66 YSPPCEAVAASFSPRDHDGD--------SFST--ADLPELPG-DAVKQSFVCDPDDETFVKNIIL 119
Fly 72 -DCMWPAMSS 80
||||...|:
Rat 120 QDCMWNGFSA 129
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2483 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR45851 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.