DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myc and max

DIOPT Version :9

Sequence 1:NP_001259204.1 Gene:Myc / 31310 FlyBaseID:FBgn0262656 Length:717 Species:Drosophila melanogaster
Sequence 2:XP_005160676.1 Gene:max / 30467 ZFINID:ZDB-GENE-990415-152 Length:165 Species:Danio rerio


Alignment Length:104 Identity:29/104 - (27%)
Similarity:53/104 - (50%) Gaps:13/104 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   625 EKRNQHNDMERQRRIGLKNLFEALKKQIPTIRDK----ERAPKVNILREAAKLCIQL-------- 677
            :||..||.:||:||..:|:.|.:|:..:|.::.:    ::|.:..||.:|.:. ||.        
Zfish    23 DKRAHHNALERKRRDHIKDSFHSLRDSVPALQGEKQSIKQASRAQILDKATEY-IQYMRRKNHTH 86

  Fly   678 TQEEKELSMQRQLLSLQLKQRQDTLASYQMELNESRSVS 716
            .|:..:|..|..||..|::..:....:.|::.|.|.|.|
Zfish    87 QQDIDDLKRQNALLEQQVRALEKVKGTTQLQANYSSSDS 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MycNP_001259204.1 HLH 625..682 CDD:238036 19/68 (28%)
maxXP_005160676.1 HLH 24..80 CDD:278439 18/56 (32%)
SlyX <86..>108 CDD:294687 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.