DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myc and Mycl

DIOPT Version :9

Sequence 1:NP_001259204.1 Gene:Myc / 31310 FlyBaseID:FBgn0262656 Length:717 Species:Drosophila melanogaster
Sequence 2:XP_006238855.1 Gene:Mycl / 298506 RGDID:1588591 Length:399 Species:Rattus norvegicus


Alignment Length:301 Identity:56/301 - (18%)
Similarity:107/301 - (35%) Gaps:97/301 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 ETPSDSD-EEIDVVSYTDKKLPTNPSCHLMGALQFQMAHKISIDHMKQKPRYNNFNLPYTPASSS 467
            |:||||: ||||||:...::           :|..:....|::......|...:|::        
  Rat   190 ESPSDSEGEEIDVVTVEKRR-----------SLDIRKPVTITVRADPLDPCMKHFHI-------- 235

  Fly   468 PVKSVANSRYPSPSSTPYQNCSSASPSYSPLSVDSSNVSSSSSSSSSQSSFTTSSSNKGRKRSSL 532
               |:...::...:..|.::||...........::..:.:.......:        .:..:...:
  Rat   236 ---SIHQQQHNYAARFPPESCSQEGDPEPGAQEEALEIEAPKEKEEEE--------EEEEEEEEI 289

  Fly   533 KDPGLLISSSSVYLPGVNNKVTHSSMMSKKSRGKKVVGTSSGNTSPISSGQDVDAMDRNWQRRSG 597
            ..|           |.|.|:...|.                 :..|:||                
  Rat   290 VSP-----------PPVENEAPQSC-----------------HPKPVSS---------------- 310

  Fly   598 GIATSTSSNSSVHRKDFVLGFDEADTIEKRNQHNDMERQRRIGLKNLFEALKKQIPTIRDKERAP 662
                                  :.:.:.||..||.:||:||..|::.|.||:.|:||:....:||
  Rat   311 ----------------------DTEDVTKRKNHNFLERKRRNDLRSRFLALRDQVPTLASCSKAP 353

  Fly   663 KVNILREAAKLCIQLTQEEKELSMQRQLLSLQLKQRQDTLA 703
            ||.||.:|.:....|...||:::.:::.|..:.:|.|..:|
  Rat   354 KVVILSKALEYLQALVGAEKKMATEKRQLRCRQQQLQKRIA 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MycNP_001259204.1 HLH 625..682 CDD:238036 23/56 (41%)
MyclXP_006238855.1 Myc_N 26..249 CDD:279405 16/80 (20%)
HLH 314..368 CDD:238036 22/53 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11367
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45851
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.