DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myc and Mycs

DIOPT Version :9

Sequence 1:NP_001259204.1 Gene:Myc / 31310 FlyBaseID:FBgn0262656 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_034980.2 Gene:Mycs / 17870 MGIID:1332242 Length:431 Species:Mus musculus


Alignment Length:276 Identity:64/276 - (23%)
Similarity:99/276 - (35%) Gaps:98/276 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   473 ANSRYPSPSSTPYQNCSSASPSYSPLSV-DSSNVSSS-----SSSSS---------------SQS 516
            ||.|.|.|..|...:..||      :|: |...:|||     |:|.|               :|.
Mouse   198 ANKREPMPVPTIPTSTGSA------ISLGDHQGLSSSLEDFLSNSGSVEEGGEEIYVVMLEETQF 256

  Fly   517 SFTTSS-SNKGRKRSSLKDPGLLISSSSVY----------------LPGVNNK--------VTHS 556
            |.|.|. .....:.::...||...||..:.                ||.|:.:        .:|:
Mouse   257 SKTVSRLPTAAHQENAALSPGCAQSSELILKRYDLIQEQHNYAAPPLPYVDREDARPQKKPRSHT 321

  Fly   557 SMMSKKSRGKKVVGTSSGNTSPISSGQDVDAMDRNWQRRSGGIATSTSSNSSVHRKDFVLGFDEA 621
            |:..|.....|.....|.|.|             :|                             
Mouse   322 SLALKCVFRPKAPRLGSRNNS-------------DW----------------------------- 344

  Fly   622 DTIEKRNQHNDMERQRRIGLKNLFEALKKQIPTIRDKERAPKVNILREAAKLCIQLTQEEKELSM 686
            :.||:|..||.||||||..:::.|..|:..:|.:...|:|.||.||::|.:....|..:|.:|.:
Mouse   345 ENIERRRNHNRMERQRRDIMRSSFLNLRDLVPELVHNEKAAKVVILKKATEYIHTLQADESKLLV 409

  Fly   687 QRQLLSLQLKQRQDTL 702
            :|:    :|.:||..|
Mouse   410 ERK----KLYERQQQL 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MycNP_001259204.1 HLH 625..682 CDD:238036 21/56 (38%)
MycsNP_034980.2 Myc_N 10..328 CDD:279405 30/135 (22%)
HLH 348..405 CDD:238036 21/56 (38%)
Leucine-zipper 400..421 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11577
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43695
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45851
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.