DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myc and Myc

DIOPT Version :9

Sequence 1:NP_001259204.1 Gene:Myc / 31310 FlyBaseID:FBgn0262656 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_034979.3 Gene:Myc / 17869 MGIID:97250 Length:454 Species:Mus musculus


Alignment Length:267 Identity:80/267 - (29%)
Similarity:123/267 - (46%) Gaps:41/267 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   462 TPASSSPVKSVANSRYP-SPSSTPYQNCSSASPSYSPLSVDSSNVSSSSSSSSS--------QSS 517
            |.|:|..:.......|| :.||:|....||.|.::||.|  .|.:||.||..:|        ::.
Mouse   198 TAAASECIDPSVVFPYPLNDSSSPKSCTSSDSTAFSPSS--DSLLSSESSPRASPEPLVLHEETP 260

  Fly   518 FTTSSSNKGRKR----------SSLKDPGLLISSSSVYLPGVNNKVTHSSMMSKKSRGKKVVGTS 572
            .||||.::..:.          ...:.|.....|.|....| ::|..||.::.|:..    |.|.
Mouse   261 PTTSSDSEEEQEDEEEIDVVSVEKRQTPAKRSESGSSPSRG-HSKPPHSPLVLKRCH----VSTH 320

  Fly   573 SGN-TSPISSGQDVDAMDRNWQRRSGGIATSTSSN---SSVHRKDFVLGFDEADTIEKRNQHNDM 633
            ..| .:|.|:.:|..|..|. :..||.:....|:|   ||....|       .:..:||..||.:
Mouse   321 QHNYAAPPSTRKDYPAAKRA-KLDSGRVLKQISNNRKCSSPRSSD-------TEENDKRRTHNVL 377

  Fly   634 ERQRRIGLKNLFEALKKQIPTIRDKERAPKVNILREAAKLCIQLTQEEKELSMQRQLLSL---QL 695
            |||||..||..|.||:.|||.:.:.|:||||.||::|....:.:..:|.:|:.::.||..   ||
Mouse   378 ERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSIQADEHKLTSEKDLLRKRREQL 442

  Fly   696 KQRQDTL 702
            |.:.:.|
Mouse   443 KHKLEQL 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MycNP_001259204.1 HLH 625..682 CDD:238036 25/56 (45%)
MycNP_034979.3 Myc_N 21..360 CDD:279405 47/184 (26%)
HLH 367..426 CDD:238036 24/58 (41%)
Myc-LZ 423..452 CDD:280500 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11577
eggNOG 1 0.900 - - E1_KOG2483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 1.056642 Normalized mean entropy S7029
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43695
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45851
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4673
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.