DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myc and Mnt

DIOPT Version :9

Sequence 1:NP_001259204.1 Gene:Myc / 31310 FlyBaseID:FBgn0262656 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_034943.3 Gene:Mnt / 17428 MGIID:109150 Length:591 Species:Mus musculus


Alignment Length:311 Identity:65/311 - (20%)
Similarity:110/311 - (35%) Gaps:90/311 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 QMAHKISIDHMKQKPRYNNFNLPYTPASSSPVKSVANSRYPSPSSTPYQNCSSASPSYSPLSVDS 502
            ::||.:.:    ::||.....||.:|.:..|..       |.|.:||           :||:|..
Mouse    50 RLAHALPV----EEPRIEAPPLPLSPPAPPPAP-------PPPLATP-----------APLTVIP 92

  Fly   503 SNVSSSSSSSSSQSSFTTSSSN----KGRKRSSLKDPGLLISSSSVYLPGVNNKVTHSSMMSKKS 563
            ..|.::|..|.........::.    ..|:.:.:..|||.| ...|.||......|.:.::.   
Mouse    93 IPVVTNSPQSLPPPPPLPPAAQPLPLAPRQPALVSTPGLSI-KEPVTLPTRPQVPTPAPLLP--- 153

  Fly   564 RGKKVVGTSSGNTSPISS---------------------------------GQDVDAMDRNWQRR 595
             ..|.....:|:..|:..                                 ....:|.....::|
Mouse   154 -DAKTTVAPTGSPKPLQPLPAPILTIAPHPGVQPQLAPQQPPPPTLGTLKLAPAEEAKSSEQKKR 217

  Fly   596 SGGIATSTSSNSSVHRKDFVLGFDEADTIEKRNQHNDMERQRRIGLKNLFEALKKQIPTIRDKER 660
            .|||.|                         |..||.:|:.||..||..||.||:.||.:.|| :
Mouse   218 PGGIGT-------------------------REVHNKLEKNRRAHLKECFETLKRNIPNVDDK-K 256

  Fly   661 APKVNILREAAKLCIQLTQEEKELSMQRQLLSLQLKQRQDTLASYQMELNE 711
            ...:::||.|.:....|.::|||...:.:.|:.:....|..||..:.||::
Mouse   257 TSNLSVLRTALRYIQSLKRKEKEYEHEMERLAREKIATQQRLAELKHELSQ 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MycNP_001259204.1 HLH 625..682 CDD:238036 20/56 (36%)
MntNP_034943.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..122 18/93 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..223 5/40 (13%)
HLH 224..274 CDD:278439 19/50 (38%)
Leucine-zipper 273..301 8/27 (30%)
DUF2630 281..339 CDD:287859 6/27 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.