DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myc and Mxd3

DIOPT Version :9

Sequence 1:NP_001259204.1 Gene:Myc / 31310 FlyBaseID:FBgn0262656 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_057871.2 Gene:Mxd3 / 17121 MGIID:104987 Length:206 Species:Mus musculus


Alignment Length:91 Identity:28/91 - (30%)
Similarity:54/91 - (59%) Gaps:7/91 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   627 RNQHNDMERQRRIGLKNLFEALKKQIPTIRDKERAPKVNILREAAKLCIQLTQEEKELSMQRQLL 691
            |:.||::|::||..||...|.|::|:|...|..|...:::||. |::.||..:|:::   |.:.|
Mouse    59 RSVHNELEKRRRAQLKRCLEQLRQQMPLGVDCTRYTTLSLLRR-ARVHIQKLEEQEQ---QARRL 119

  Fly   692 SLQLKQRQDTLASYQMELNESRSVSG 717
            ..:|:.:|.:|   |.:|.:.:.:.|
Mouse   120 KEKLRSKQQSL---QQQLEQLQGLPG 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MycNP_001259204.1 HLH 625..682 CDD:238036 20/54 (37%)
Mxd3NP_057871.2 Interaction with SIN3A and SIN3B. /evidence=ECO:0000269|PubMed:8521822 8..25
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..66 3/6 (50%)
HLH 63..115 CDD:197674 18/55 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..171 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2483
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.